SLC38A4 Antibody

Images

 
Western Blot: SLC38A4 Antibody [NBP1-55228] - WB analysis of SLC38A4 in Hep3B WCL.
Immunohistochemistry-Paraffin: SLC38A4 Antibody [NBP1-55228] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: SLC38A4 Antibody [NBP1-55228] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A4 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC38A4(solute carrier family 38, member 4) The peptide sequence was selected from the middle region of SLC38A4. Peptide sequence LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC38A4 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC38A4 Antibody

  • Amino acid transporter A3
  • ATA3MGC126876
  • FLJ10191
  • N amino acid transporter 3
  • Na(+)-coupled neutral amino acid transporter 4
  • NAT3amino acid transporter system A3
  • PAAT
  • SNAT4
  • sodium-coupled neutral amino acid transporter 4
  • Solute carrier family 38 member 4
  • solute carrier family 38, member 4
  • System A amino acid transporter 3
  • System N amino acid transporter 3

Background

SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-60103
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC
NBP1-81010
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-60120
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, TCS
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-53124
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-88153
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-89327
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37343
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-57015
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB

Publications for SLC38A4 Antibody (NBP1-55228) (0)

There are no publications for SLC38A4 Antibody (NBP1-55228).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A4 Antibody (NBP1-55228) (0)

There are no reviews for SLC38A4 Antibody (NBP1-55228). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC38A4 Antibody (NBP1-55228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC38A4 Products

Bioinformatics Tool for SLC38A4 Antibody (NBP1-55228)

Discover related pathways, diseases and genes to SLC38A4 Antibody (NBP1-55228). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC38A4 Antibody (NBP1-55228)

Discover more about diseases related to SLC38A4 Antibody (NBP1-55228).
 

Pathways for SLC38A4 Antibody (NBP1-55228)

View related products by pathway.

PTMs for SLC38A4 Antibody (NBP1-55228)

Learn more about PTMs related to SLC38A4 Antibody (NBP1-55228).

Blogs on SLC38A4

There are no specific blogs for SLC38A4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A4
Uniprot