SLC25A32 Antibody


Immunohistochemistry-Paraffin: SLC25A32 Antibody [NBP2-13322] Staining of human stomach, upper shows strong nuclear positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

SLC25A32 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRF AVSDGLELRPKYNGILHCLTTIWKLDGLR
Specificity of human SLC25A32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A32 Protein (NBP2-13322PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC25A32 Antibody

  • mitochondrial folate transporter/carrier
  • Solute carrier family 25 member 32
  • solute carrier family 25, member 32


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow

Publications for SLC25A32 Antibody (NBP2-13322) (0)

There are no publications for SLC25A32 Antibody (NBP2-13322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A32 Antibody (NBP2-13322) (0)

There are no reviews for SLC25A32 Antibody (NBP2-13322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC25A32 Antibody (NBP2-13322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC25A32 Products

Bioinformatics Tool for SLC25A32 Antibody (NBP2-13322)

Discover related pathways, diseases and genes to SLC25A32 Antibody (NBP2-13322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A32 Antibody (NBP2-13322)

Discover more about diseases related to SLC25A32 Antibody (NBP2-13322).

Pathways for SLC25A32 Antibody (NBP2-13322)

View related products by pathway.

Blogs on SLC25A32

There are no specific blogs for SLC25A32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC25A32 Antibody and receive a gift card or discount.


Gene Symbol SLC25A32