DHRS4 Antibody

Images

 
Western Blot: DHRS4 Antibody [NBP1-83790] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DHRS4 Antibody [NBP1-83790] - Staining of human cell line A-431 shows positivity in nuclear membrane and vesicles.
Immunohistochemistry-Paraffin: DHRS4 Antibody [NBP1-83790] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHRS4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGT
Specificity
Specificity of human DHRS4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHRS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Fixation/Permeabilization: PFA/Triton X-100 is recommended.
Control Peptide
DHRS4 Protein (NBP1-83790PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHRS4 Antibody

  • CR
  • dehydrogenase/reductase (SDR family) member 4 like 2A
  • dehydrogenase/reductase (SDR family) member 4
  • dehydrogenase/reductase SDR family member 4
  • EC 1.1.1
  • EC 1.1.1.184
  • FLJ11008
  • humNRDR
  • NADP-dependent retinol dehydrogenase
  • NRDRNADPH-dependent retinol dehydrogenase/reductase
  • Peroxisomal short-chain alcohol dehydrogenase
  • PHCR
  • PSCD
  • SCAD-SRLNADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase
  • SDR25C1
  • SDR25C2
  • SDR-SRL
  • short chain dehydrogenase/reductase family 25C, member 1
  • short chain dehydrogenase/reductase family 25C, member 2
  • Short-chain dehydrogenase/reductase family member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00347527-P01
Species: Hu
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF

Publications for DHRS4 Antibody (NBP1-83790) (0)

There are no publications for DHRS4 Antibody (NBP1-83790).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRS4 Antibody (NBP1-83790) (0)

There are no reviews for DHRS4 Antibody (NBP1-83790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DHRS4 Antibody (NBP1-83790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DHRS4 Antibody (NBP1-83790)

Discover related pathways, diseases and genes to DHRS4 Antibody (NBP1-83790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHRS4 Antibody (NBP1-83790)

Discover more about diseases related to DHRS4 Antibody (NBP1-83790).
 

Pathways for DHRS4 Antibody (NBP1-83790)

View related products by pathway.

PTMs for DHRS4 Antibody (NBP1-83790)

Learn more about PTMs related to DHRS4 Antibody (NBP1-83790).
 

Research Areas for DHRS4 Antibody (NBP1-83790)

Find related products by research area.

Blogs on DHRS4

There are no specific blogs for DHRS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHRS4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRS4