SLC25A20 Antibody

Images

 
Western Blot: SLC25A20 Antibody [NBP1-59574] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

SLC25A20 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC25A20(solute carrier family 25 (carnitine/acylcarnitine translocase), member 20) The peptide sequence was selected from the C terminal of SLC25A20 (NP_000378). Peptide sequence GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFR
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC25A20 Antibody

  • CACCarnitine/acylcarnitine translocase
  • CACTSolute carrier family 25 member 20
  • mitochondrial carnitine/acylcarnitine carrier protein
  • solute carrier family 25 (carnitine/acylcarnitine translocase), member 20

Background

SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.It mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB
NBP1-84366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC25A20 Antibody (NBP1-59574) (0)

There are no publications for SLC25A20 Antibody (NBP1-59574).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A20 Antibody (NBP1-59574) (0)

There are no reviews for SLC25A20 Antibody (NBP1-59574). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A20 Antibody (NBP1-59574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A20 Antibody Products

Related Products by Gene

Bioinformatics Tool for SLC25A20 Antibody (NBP1-59574)

Discover related pathways, diseases and genes to SLC25A20 Antibody (NBP1-59574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A20 Antibody (NBP1-59574)

Discover more about diseases related to SLC25A20 Antibody (NBP1-59574).
 

Pathways for SLC25A20 Antibody (NBP1-59574)

View related products by pathway.

PTMs for SLC25A20 Antibody (NBP1-59574)

Learn more about PTMs related to SLC25A20 Antibody (NBP1-59574).

Blogs on SLC25A20

There are no specific blogs for SLC25A20, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SLC25A20
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59574 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

SLC25A20 Recombinant Protein
H00000788-P01-10ug
SLC25A20 RNAi
H00000788-R01-20nmol