SLC22A17 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC22A17 Antibody [NBP1-88554] - Staining of human cell line U-251MG shows positivity in nucleus, nuclear membrane and cytoplasm.
Immunohistochemistry-Paraffin: SLC22A17 Antibody [NBP1-88554] - Staining of human hippocampus shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC22A17 Protein (NBP1-88554PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A17 Antibody

  • 24p3R
  • BOCTNGALR3
  • BOIThBOIT
  • Brain-type organic cation transporter
  • Lipocalin-2 receptor
  • Neutrophil gelatinase-associated lipocalin receptor
  • NgalR
  • NGALR2
  • NGALRNGAL receptor
  • potent brain type organic ion transporter
  • solute carrier family 22 (organic cation transporter), member 17
  • solute carrier family 22 member 17,24p3 receptor
  • solute carrier family 22, member 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1857
Species: Mu
Applications: WB, Simple Western, IP
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF5249
Species: Hu
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP2-02651
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-88554
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC22A17 Antibody (NBP1-88554) (0)

There are no publications for SLC22A17 Antibody (NBP1-88554).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A17 Antibody (NBP1-88554) (0)

There are no reviews for SLC22A17 Antibody (NBP1-88554). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC22A17 Antibody (NBP1-88554) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A17 Products

Bioinformatics Tool for SLC22A17 Antibody (NBP1-88554)

Discover related pathways, diseases and genes to SLC22A17 Antibody (NBP1-88554). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A17 Antibody (NBP1-88554)

Discover more about diseases related to SLC22A17 Antibody (NBP1-88554).
 

Pathways for SLC22A17 Antibody (NBP1-88554)

View related products by pathway.

Blogs on SLC22A17

There are no specific blogs for SLC22A17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A17