Cochlin Antibody


Western Blot: COCH Antibody [NBP1-69141] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Cochlin Antibody Summary

Synthetic peptides corresponding to COCH (coagulation factor C homolog, cochlin (Limulus polyphemus)) The peptide sequence was selected from the C terminal of COCH. Peptide sequence VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against COCH and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cochlin Antibody

  • coagulation factor C (Limulus polyphemus homolog); cochlin
  • coagulation factor C homolog, cochlin (Limulus polyphemus)
  • COCH
  • COCH5B2
  • Cochlin
  • DFNA31
  • DFNA9


The protein encoded by this gene is highly conserved in human, mouse, and chicken, showing 94% and 79% amino acid identity of human to mouse and chicken sequences, respectively. Hybridization to this gene was detected in spindle-shaped cells located along nerve fibers between the auditory ganglion and sensory epithelium. These cells accompany neurites at the habenula perforata, the opening through which neurites extend to innervate hair cells. This and the pattern of expression of this gene in chicken inner ear paralleled the histologic findings of acidophilic deposits, consistent with mucopolysaccharide ground substance, in temporal bones from DFNA9 (autosomal dominant nonsyndromic sensorineural deafness 9) patients. Mutations that cause DFNA9 have been reported in this gene. Alternative splicing results in multiple transcript variants encoding the same protein. Additional splice variants encoding distinct isoforms have been described but their biological validities have not been demonstrated.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: WB

Publications for Cochlin Antibody (NBP1-69141) (0)

There are no publications for Cochlin Antibody (NBP1-69141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cochlin Antibody (NBP1-69141) (0)

There are no reviews for Cochlin Antibody (NBP1-69141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cochlin Antibody (NBP1-69141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cochlin Products

Bioinformatics Tool for Cochlin Antibody (NBP1-69141)

Discover related pathways, diseases and genes to Cochlin Antibody (NBP1-69141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cochlin Antibody (NBP1-69141)

Discover more about diseases related to Cochlin Antibody (NBP1-69141).

Pathways for Cochlin Antibody (NBP1-69141)

View related products by pathway.

PTMs for Cochlin Antibody (NBP1-69141)

Learn more about PTMs related to Cochlin Antibody (NBP1-69141).

Blogs on Cochlin

There are no specific blogs for Cochlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cochlin Antibody and receive a gift card or discount.


Gene Symbol COCH