SLC22A23 Antibody

Images

 
Western Blot: SLC22A23 Antibody [NBP1-91154] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: SLC22A23 Antibody [NBP1-91154] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemistry-Paraffin: SLC22A23 Antibody [NBP1-91154] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PESRDQNLPENISNGEHYTRQPLLPHKKGEQPLLLTNAELKDYSGLHDAAAAGDTLPEGATANGMKAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC22A23 Protein (NBP1-91154PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A23 Antibody

  • solute carrier family 22, member 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-52963
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP2-31914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89295
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32395
Species: Hu
Applications: IHC, IHC-P
NBP2-57222
Species: Hu
Applications: ICC/IF
H00347527-B01P
Species: Hu
Applications: WB, ELISA
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP2-01360
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84104
Species: Hu
Applications: IHC, IHC-P
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
AF4856
Species: Hu, Mu, Rt
Applications: WB
NBP2-14247
Species: Hu
Applications: IHC, IHC-P
NBP1-93466
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82716
Species: Hu
Applications: IHC, IHC-P
NBP2-38151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC22A23 Antibody (NBP1-91154) (0)

There are no publications for SLC22A23 Antibody (NBP1-91154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A23 Antibody (NBP1-91154) (0)

There are no reviews for SLC22A23 Antibody (NBP1-91154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC22A23 Antibody (NBP1-91154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A23 Products

Bioinformatics Tool for SLC22A23 Antibody (NBP1-91154)

Discover related pathways, diseases and genes to SLC22A23 Antibody (NBP1-91154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A23 Antibody (NBP1-91154)

Discover more about diseases related to SLC22A23 Antibody (NBP1-91154).
 

Pathways for SLC22A23 Antibody (NBP1-91154)

View related products by pathway.

Blogs on SLC22A23

There are no specific blogs for SLC22A23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A23