SLC6A19 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Analysis in human small intestine and pancreas tissues using NBP2-48784 antibody. Corresponding SLC6A19 RNA-seq data are ...read more
Immunocytochemistry/ Immunofluorescence: SLC6A19 Antibody [NBP2-48784] - Staining of human cell line HEL shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human pancreas shows no membranous positivity in exocrine glanular cells as expected.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human stomach shows no membranous positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC6A19 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
SLC6A19 Recombinant Protein Antigen (NBP2-48784PEP)

Reactivity Notes

Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC6A19 Antibody

  • B0AT1
  • FLJ20680
  • FLJ34635
  • HND
  • sodium-dependent amino acid transporter system B0
  • sodium-dependent neutral amino acid transporter B(0)AT1
  • solute carrier family 6 (neurotransmitter transporter), member 19
  • solute carrier family 6 (neutral amino acid transporter), member 19
  • Solute carrier family 6 member 19
  • System B(0) neutral amino acid transporter AT1
  • system B0 neutral amino acid transporter

Background

SLC6A19 encodes a system B(0) transmembrane protein that actively transports most neutral amino acids across the apical membrane of epithelial cells. Mutations in this gene result in Hartnup disorder. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC6A19 Antibody (NBP2-48784) (0)

There are no publications for SLC6A19 Antibody (NBP2-48784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A19 Antibody (NBP2-48784) (0)

There are no reviews for SLC6A19 Antibody (NBP2-48784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC6A19 Antibody (NBP2-48784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A19