SLBP Antibody - BSA Free

Western Blot: SLBP Antibody [NBP2-56007] - Analysis using Anti-SLBP antibody NBP2-56007 (A) shows similar pattern to independent antibody NBP1-83290 (B).

Immunocytochemistry/Immunofluorescence: SLBP Antibody [NBP2-56007] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLBP Antibody - BSA Free (NBP2-56007) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLBP Recombinant Protein Antigen (NBP2-56007PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLBP Antibody - BSA Free

• histone binding protein
• histone RNA hairpin-binding protein
• histone stem-loop binding protein
• Histone stem-loop-binding protein
• histone
• stem-loop binding protein

Background

SLBP encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLBP