SLBP Antibody

Images

 
Independent Antibodies: Western Blot: SLBP Antibody [NBP2-56007] - Analysis using Anti-SLBP antibody NBP2-56007 (A) shows similar pattern to independent antibody NBP1-83290 (B).
Immunocytochemistry/ Immunofluorescence: SLBP Antibody [NBP2-56007] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

SLBP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAM
Specificity
Specificity of human SLBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLBP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLBP Recombinant Protein Antigen (NBP2-56007PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLBP Antibody

  • histone binding protein
  • histone RNA hairpin-binding protein
  • histone stem-loop binding protein
  • Histone stem-loop-binding protein
  • histone
  • stem-loop binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2200
Species: Hu
Applications: WB, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB5285
Species: Hu
Applications: WB, Simple Western
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88027
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-83996
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP3-04382
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF7974
Species: Mu
Applications: WB
NBP2-37550
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56007
Species: Hu
Applications: WB, ICC/IF

Publications for SLBP Antibody (NBP2-56007) (0)

There are no publications for SLBP Antibody (NBP2-56007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLBP Antibody (NBP2-56007) (0)

There are no reviews for SLBP Antibody (NBP2-56007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLBP Antibody (NBP2-56007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLBP Products

Array NBP2-56007

Bioinformatics Tool for SLBP Antibody (NBP2-56007)

Discover related pathways, diseases and genes to SLBP Antibody (NBP2-56007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLBP Antibody (NBP2-56007)

Discover more about diseases related to SLBP Antibody (NBP2-56007).
 

Pathways for SLBP Antibody (NBP2-56007)

View related products by pathway.

PTMs for SLBP Antibody (NBP2-56007)

Learn more about PTMs related to SLBP Antibody (NBP2-56007).

Blogs on SLBP

There are no specific blogs for SLBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLBP