SKAR Antibody

Images

 
Western Blot: SKAR Antibody [NBP1-92392] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SKAR Antibody [NBP1-92392] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SKAR Antibody [NBP1-92392] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Western Blot: SKAR Antibody [NBP1-92392] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKAR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR
Specificity
Specificity of human, mouse, rat SKAR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLDIP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
SKAR Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKAR Antibody

  • KIAA1649polymerase delta interacting protein 46
  • p46
  • PDIP46S6K1 Aly/REF-like target
  • polymerase (DNA-directed), delta interacting protein 3
  • RNA-binding protein P46
  • SKARpolymerase delta-interacting protein 3,46 kDa DNA polymerase delta interaction protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-84676
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1556
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, ICC
NBP2-15180
Species: Hu, Mu
Applications: WB, ICC/IF
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
MAB3468
Species: Hu
Applications: WB, ICC
NBP1-84675
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SKAR Antibody (NBP1-92392) (0)

There are no publications for SKAR Antibody (NBP1-92392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKAR Antibody (NBP1-92392) (0)

There are no reviews for SKAR Antibody (NBP1-92392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SKAR Antibody (NBP1-92392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SKAR Products

Bioinformatics Tool for SKAR Antibody (NBP1-92392)

Discover related pathways, diseases and genes to SKAR Antibody (NBP1-92392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKAR Antibody (NBP1-92392)

Discover more about diseases related to SKAR Antibody (NBP1-92392).
 

Pathways for SKAR Antibody (NBP1-92392)

View related products by pathway.

PTMs for SKAR Antibody (NBP1-92392)

Learn more about PTMs related to SKAR Antibody (NBP1-92392).

Blogs on SKAR

There are no specific blogs for SKAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLDIP3