CDK20 Antibody - BSA Free

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.

Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Analysis in human fallopian tube and skeletal muscle tissues using NBP1-91214 antibody. Corresponding CDK20 RNA-seq data are presented for the same tissues.

Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human skeletal muscle shows no positivity in a subset of myocytes as expected.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDK20 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CDK20 Antibody - BSA Free (NBP1-91214) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CDK20 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CDK20 Protein (NBP1-91214PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDK20 Antibody - BSA Free

• CAK-kinase p42
• CCRK
• CCRKEC 2.7.11.22
• CDCH
• CDCHP42
• CDK20
• CDK-activating kinase p42
• cell cycle related kinase
• Cell cycle-related kinase
• Cell division protein kinase 20
• cyclin-dependent kinase 20
• Cyclin-dependent protein kinase H
• Cyclin-kinase-activating kinase p42
• EC 2.7.11
• p42
• PNQALRE

Background

CCRK is encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDK20 Antibody (NBP1-91214)(1)

Publication using NBP1-91214

• Ashraf S, Kudo H, Rao J et al. Mutations in six nephrosis genes delineate a pathogenic pathway amenable to treatment Nat Commun 2018-05-17 [PMID: 29773874] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: CDK20