CDK20 Antibody


Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining in human fallopian tube and skeletal muscle tissues using anti-CDK20 antibody. Corresponding CDK20 RNA-seq data are more
Orthogonal Strategies: Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding CDK20 RNA-seq data are presented for the same more
Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Validated by:

Orthogonal Strategies


Order Details

CDK20 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDK20 Protein (NBP1-91214PEP)
Read Publication using
NBP1-91214 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDK20 Antibody

  • CAK-kinase p42
  • CCRK
  • CDCH
  • CDCHP42
  • CDK20
  • CDK-activating kinase p42
  • cell cycle related kinase
  • Cell cycle-related kinase
  • Cell division protein kinase 20
  • cyclin-dependent kinase 20
  • Cyclin-dependent protein kinase H
  • Cyclin-kinase-activating kinase p42
  • EC 2.7.11
  • p42


CCRK is encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDK20 Antibody (NBP1-91214)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for CDK20 Antibody (NBP1-91214) (0)

There are no reviews for CDK20 Antibody (NBP1-91214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK20 Antibody (NBP1-91214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDK20 Products

Research Areas for CDK20 Antibody (NBP1-91214)

Find related products by research area.

Blogs on CDK20

There are no specific blogs for CDK20, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDK20 Antibody and receive a gift card or discount.


Gene Symbol CDK20