CDKL1 Antibody

Images

 
Western Blot: CDKL1 Antibody [NBP2-32482] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: CDKL1 Antibody [NBP2-32482] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: CDKL1 Antibody [NBP2-32482] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDKL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDKL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDKL1 Protein (NBP2-32482PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDKL1 Antibody

  • CDC2-related kinase 1
  • cyclin-dependent kinase-like 1 (CDC2-related kinase)
  • cyclin-dependent kinase-like 1
  • EC 2.7.11
  • EC 2.7.11.22
  • KKIALRE
  • P42
  • Protein kinase p42 KKIALRE
  • serine/threonine protein kinase KKIALRE
  • Serine/threonine-protein kinase KKIALRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDKL1 Antibody (NBP2-32482) (0)

There are no publications for CDKL1 Antibody (NBP2-32482).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL1 Antibody (NBP2-32482) (0)

There are no reviews for CDKL1 Antibody (NBP2-32482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDKL1 Antibody (NBP2-32482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDKL1 Products

Bioinformatics Tool for CDKL1 Antibody (NBP2-32482)

Discover related pathways, diseases and genes to CDKL1 Antibody (NBP2-32482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL1 Antibody (NBP2-32482)

Discover more about diseases related to CDKL1 Antibody (NBP2-32482).
 

Pathways for CDKL1 Antibody (NBP2-32482)

View related products by pathway.

PTMs for CDKL1 Antibody (NBP2-32482)

Learn more about PTMs related to CDKL1 Antibody (NBP2-32482).
 

Research Areas for CDKL1 Antibody (NBP2-32482)

Find related products by research area.

Blogs on CDKL1

There are no specific blogs for CDKL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDKL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKL1