NUP43 Antibody

Western Blot: NUP43 Antibody [NBP1-88792] - Analysis using Anti-NUP43 antibody NBP1-88792 (A) shows similar pattern to independent antibody NBP1-88793 (B).

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human colon.

Western Blot: NUP43 Antibody [NBP1-88792] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human cerebral cortex shows cytoplasmic and nuclear positivity in neuronal cells and glial cells.

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human adrenal gland, colon, kidney and testis using Anti-NUP43 antibody NBP1-88792 (A) shows similar protein distribution across tissues to independent antibody NBP1-88793 (B).

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human testis.

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human adrenal gland.

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NUP43 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUP43
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NUP43 Protein (NBP1-88792PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NUP43 Antibody

• bA350J20.1
• FLJ13287
• nucleoporin 43kDa
• nucleoporin Nup43
• Nup107-160 subcomplex subunit Nup43
• p42

Background

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUP43 Antibody (NBP1-88792)(1)

Publication using NBP1-88792

• Rossi A, Coum A, Madelenat M, et al. Neural stem cells alter nucleocytoplasmic partitioning and accumulate nuclear polyadenylated transcripts during quiescence bioRxiv 2021-01-07

Bioinformatics

• Gene Symbol: NUP43