NUP43 Antibody


Independent Antibodies: Western Blot: NUP43 Antibody [NBP1-88792] - Analysis using Anti-NUP43 antibody NBP1-88792 (A) shows similar pattern to independent antibody NBP1-88793 (B).
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human colon.
Western Blot: NUP43 Antibody [NBP1-88792] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human cerebral cortex shows cytoplasmic and nuclear positivity in neuronal cells and glial cells.
Independent Antibodies: Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human adrenal gland, colon, kidney and testis using Anti-NUP43 antibody NBP1-88792 (A) shows similar protein more
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human testis.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human adrenal gland.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human kidney.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

NUP43 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUP43 Protein (NBP1-88792PEP)
Read Publication using NBP1-88792.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NUP43 Antibody

  • bA350J20.1
  • FLJ13287
  • nucleoporin 43kDa
  • nucleoporin Nup43
  • Nup107-160 subcomplex subunit Nup43
  • p42


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NUP43 Antibody (NBP1-88792)(1)

Showing Publication 1 - 1 of 1.
Publication using NBP1-88792 Applications Species
Rossi A, Coum A, Madelenat M, et al. Neural stem cells alter nucleocytoplasmic partitioning and accumulate nuclear polyadenylated transcripts during quiescence bioRxiv Jan 7 2021

Reviews for NUP43 Antibody (NBP1-88792) (0)

There are no reviews for NUP43 Antibody (NBP1-88792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUP43 Antibody (NBP1-88792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUP43 Products

Bioinformatics Tool for NUP43 Antibody (NBP1-88792)

Discover related pathways, diseases and genes to NUP43 Antibody (NBP1-88792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NUP43 Antibody (NBP1-88792)

View related products by pathway.

Blogs on NUP43

There are no specific blogs for NUP43, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUP43 Antibody and receive a gift card or discount.


Gene Symbol NUP43