SIRT4 Antibody - BSA Free

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] - Immunohistochemistry analysis of paraffin-embedded Rat brain using SIRT4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: SIRT4 Antibody [NBP3-38446] - Western blot analysis of various lysates using SIRT4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] - Immunohistochemistry analysis of paraffin-embedded Human colon using SIRT4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using SIRT4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SIRT4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SIRT4 Antibody - BSA Free (NBP3-38446) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-313 of human SIRT4 (NP_036372.1).
  
  Sequence:
  IGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRT4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SIRT4 Antibody - BSA Free

• EC 2.4.2.-
• EC 3.5.1
• MGC130046
• MGC130047
• MGC57437
• SIR2L4
• SIR2L4NAD-dependent ADP-ribosyltransferase sirtuin-4
• sir2-like 4
• SIR2-like protein 4
• SIRT4
• sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
• sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4
• Sirtuin 4
• sirtuin type 4

Background

SIRT4 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIRT4