SIN3A Antibody - BSA Free

Immunohistochemistry-Paraffin: SIN3A Antibody [NBP2-38949] - Staining of human cerebellum, kidney, liver and testis using Anti-SIN3A antibody NBP2-38949 (A) shows similar protein distribution across tissues to independent antibody NBP2-38564 (B).

Immunocytochemistry/Immunofluorescence: SIN3A Antibody [NBP2-38949] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: SIN3A Antibody [NBP2-38949] - Staining of human cerebellum shows moderate nuclear positivity in all layers.

Immunohistochemistry-Paraffin: SIN3A Antibody [NBP2-38949] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SIN3A Antibody [NBP2-38949] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: SIN3A Antibody [NBP2-38949] - Staining of human liver shows no positivity in hepatocytes as expected.

ChIP-Exo-Seq composite graph for Anti-SIN3A (NBP2-38949) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SIN3A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SIN3A Antibody - BSA Free (NBP2-38949) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV
• Predicted Species: Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIN3A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SIN3A Protein (NBP2-38949PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SIN3A Antibody - BSA Free

• DKFZp434K2235
• FLJ90319
• Histone deacetylase complex subunit Sin3a
• KIAA0700
• paired amphipathic helix protein Sin3a
• SIN3 homolog A, transcription regulator (yeast)
• SIN3 homolog A, transcriptional regulator (yeast)
• SIN3A
• Transcriptional corepressor Sin3a
• transcriptional co-repressor Sin3A
• transcriptional regulator, SIN3A

Background

Sin3A is encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIN3A
• Uniprot:
  • Q96ST3(Human)