![Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Analysis in human endometrium and liver tissues. Corresponding CREBBP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CBP-KAT3A-Antibody-Immunohistochemistry-Paraffin-NBP2-38774-img0006.jpg "Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Analysis in human endometrium and liver tissues. Corresponding CREBBP RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CBP/KAT3A Antibody - BSA Free (NBP2-38774) is a polyclonal antibody validated for use in IHC, ELISA and ICC/IF. Anti-CBP/KAT3A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CREBBP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CBP/KAT3A Antibody (NBP2-38774)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CBP/KAT3A Antibody [NBP2-38774] - Staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CBP-KAT3A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38774-img0001.jpg "Immunocytochemistry/Immunofluorescence: CBP/KAT3A Antibody [NBP2-38774] - Staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human liver shows very weak nuclear positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/CBP-KAT3A-Antibody-Immunohistochemistry-Paraffin-NBP2-38774-img0002.jpg "Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human liver shows very weak nuclear positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human endometrium shows strong nuclear positivity in glandular cells and stromal cells.](http://images.novusbio.com/fullsize/CBP-KAT3A-Antibody-Immunohistochemistry-Paraffin-NBP2-38774-img0003.jpg "Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human endometrium shows strong nuclear positivity in glandular cells and stromal cells.")
![Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CBP-KAT3A-Antibody-Immunohistochemistry-Paraffin-NBP2-38774-img0004.jpg "Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/CBP-KAT3A-Antibody-Immunohistochemistry-Paraffin-NBP2-38774-img0005.jpg "Immunohistochemistry-Paraffin: CBP/KAT3A Antibody [NBP2-38774] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")