Sigma-1 R/OPRS1 Antibody - BSA Free

Western Blot: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Analysis in human cell lines PC-3 and MCF-7 using Anti-SIGMAR1 antibody. Corresponding SIGMAR1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human gastrointestinal shows moderate cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human Fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Simple Western lane view shows a specific band for SIGMAR1 in 0.2 mg/ml of Liver (left), RT-4 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Electropherogram image(s) of corresponding Simple Western lane view. Sigma-1 R/OPRS1 antibody was used at 1:20 dilution on Liver lysate(s).

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Electropherogram image(s) of corresponding Simple Western lane view. Sigma-1 R/OPRS1 antibody was used at 1:20 dilution on RT-4 lysate(s).

• Reactivity: Hu, Rt, Mu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sigma-1 R/OPRS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Sigma-1 R/OPRS1 Antibody - BSA Free (NBP1-82479) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-Sigma-1 R/OPRS1 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
• Predicted Species: Mouse (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIGMAR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in Liver, RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 29 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  Sigma-1 R/OPRS1 Protein (NBP1-82479PEP)

Reactivity Notes

Use in Rat reported in scientific literature (PMID:35040378).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sigma-1 R/OPRS1 Antibody - BSA Free

• Aging-associated gene 8 protein
• ALS16
• FLJ25585
• hSigmaR1
• OPRS1
• SIG-1R
• sigma 1
• Sigma 1-type opioid receptor
• sigma non-opioid intracellular receptor 1
• Sigma-1 R
• sigma1 receptor
• Sigma1R
• Sigma-1R
• sigma1-receptor
• SIGMAR1
• SR31747 binding protein 1
• SR31747-binding protein
• SRBP
• SR-BP
• SR-BP1
• SRBPMGC3851
• type I sigma receptor

Background

OPRS1 encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longest isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sigma-1 R/OPRS1 Antibody (NBP1-82479)(4)

Publications using NBP1-82479

• Hornung RS, Raut NG, Cantu DJ et al. Sigma-1 receptors and progesterone metabolizing enzymes in nociceptive sensory neurons of the female rat trigeminal ganglia: A neural substrate for the antinociceptive actions of progesterone Molecular pain 2022-01-18 [PMID: 35040378] (WB, Rat)
• OrtIz-RenterIa M, JuArez-Contreras R, GonzAlez-RamIrez R et al. TRPV1 channels and the progesterone receptor Sig-1R interact to regulate pain Proc Natl Acad Sci U S A. 2018-02-12 [PMID: 29378958] (WB, Human)
• Sun B, Kawahara M, Nagamune T. Modeling tandem AAG8-MEK inhibition in melanoma cells. Cancer Med 2014-06-01 [PMID: 24634165] (WB)
• Chiabrando D, Marro S, Mercurio S et al. The mitochondrial heme exporter FLVCR1b mediates erythroid differentiation. J Clin Invest 2012-12-01 [PMID: 23187127]

Bioinformatics

• Gene Symbol: SIGMAR1