Sialin/SLC17A5 Antibody - Azide and BSA Free

Western Blot: Sialin/SLC17A5 Antibody [NBP2-94758] - Analysis of extracts of various cell lines, using Sialin/SLC17A5 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.

• Reactivity: Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Sialin/SLC17A5 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A5 (NP_036566.1). MRSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC17A5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Sialin/SLC17A5 Antibody - Azide and BSA Free

• AST
• ASTSodium/sialic acid cotransporter
• FLJ22227
• FLJ23268
• ISSD
• Membrane glycoprotein HP59
• NSD
• SD
• sialic acid storage disease
• Sialin
• SIASD
• SLC17A5
• SLD
• SLDSolute carrier family 17 member 5
• solute carrier family 17 (anion/sugar transporter), member 5
• solute carrier family 17, member 5

Background

The SLC17A5 gene encodes a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in this gene cause sialic acid storage diseases, including infantile sialic acid storage disor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC17A5