SGPP1 Antibody


Western Blot: SGPP1 Antibody [NBP1-91353] - Differential expression of SGPP1 and SPL in normal FLS and RAFLS. Proteins from whole cell lysates were prepared for Western blot. Total PI3-kinase p85 subunit was used as a more
Western Blot: SGPP1 Antibody [NBP1-91353] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Differential expression of SGPP1 and SPL in normal FLS and RAFLS. Human primary FLS from normal (n = 4) and RA (n = 4) donors were incubated with or without 200 uM CoCl2 for 24 h. Total RNA was extracted for more

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

SGPP1 Antibody Summary

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Read Publications using
NBP1-91353 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25908616).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for SGPP1 Antibody

  • sphingosine-1-phosphate phosphatase 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SGPP1 Antibody (NBP1-91353)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for SGPP1 Antibody (NBP1-91353) (0)

There are no reviews for SGPP1 Antibody (NBP1-91353). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGPP1 Antibody (NBP1-91353) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SGPP1 Antibody and receive a gift card or discount.


Gene Symbol SGPP1