SGPP1 Antibody

Images

 
Western Blot: SGPP1 Antibody [NBP1-91353] - Differential expression of SGPP1 and SPL in normal FLS and RAFLS. Proteins from whole cell lysates were prepared for Western blot. Total PI3-kinase p85 subunit was used as a ...read more
Western Blot: SGPP1 Antibody [NBP1-91353] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SGPP1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%), Zebrafish (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGPP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SGPP1 and was validated on Western blot.
Publications
Read Publications using
NBP1-91353 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25908616).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SGPP1 Antibody

  • sphingosine-1-phosphate phosphatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM
Species: Hu, Mu, Rt
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91353
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for SGPP1 Antibody (NBP1-91353)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for SGPP1 Antibody (NBP1-91353) (0)

There are no reviews for SGPP1 Antibody (NBP1-91353). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGPP1 Antibody (NBP1-91353) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SGPP1 Products

Array NBP1-91353

Bioinformatics Tool for SGPP1 Antibody (NBP1-91353)

Discover related pathways, diseases and genes to SGPP1 Antibody (NBP1-91353). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGPP1 Antibody (NBP1-91353)

Discover more about diseases related to SGPP1 Antibody (NBP1-91353).
 

Pathways for SGPP1 Antibody (NBP1-91353)

View related products by pathway.

PTMs for SGPP1 Antibody (NBP1-91353)

Learn more about PTMs related to SGPP1 Antibody (NBP1-91353).

Blogs on SGPP1

There are no specific blogs for SGPP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGPP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGPP1
Uniprot