SGPP1 Antibody - BSA Free

SGPP1-Antibody-Western-Blot-NBP1-91353-img0005.jpg

Western Blot: SGPP1 Antibody [NBP1-91353] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SGPP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SGPP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25908616).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SGPP1 Antibody - BSA Free

• sphingosine-1-phosphate phosphatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SGPP1 Antibody (NBP1-91353)(3)

Publications using NBP1-91353

• Bartłomiej Łukaszuk, Elżbieta Supruniuk, Adrian Chabowski, Agnieszka Mikłosz Adipose tissue place of origin and obesity influence sphingolipid signaling pathway in the adipocytes differentiated from ADMSCs isolated from morbidly obese women. Biochemical pharmacology 2024-03-21 [PMID: 38521475]
• Zhao Chenqi, Moreno-Nieves Uriel, Di Battista John A et al. Chemical Hypoxia Brings to Light Altered Autocrine Sphingosine-1-Phosphate Signalling in Rheumatoid Arthritis Synovial Fibroblasts. Mediators of Inflammation 2015-01-01 [PMID: 26556954] (WB, Human)
• Dulneva A, Lee S, Oliver PL et al. The mutant Moonwalker TRPC3 channel links calcium signaling to lipid metabolism in the developing cerebellum Hum. Mol. Genet. 2015-04-23 [PMID: 25908616] (WB, Mouse)

Bioinformatics

• Gene Symbol: SGPP1
• Uniprot:
  • NP_110418(Human)