SFRS8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SFRS8 Antibody [NBP1-87052] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: SFRS8 Antibody [NBP1-87052] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SFRS8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SFRS8 Antibody - BSA Free (NBP1-87052) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFSWAP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SFRS8 Protein (NBP1-87052PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SFRS8 Antibody - BSA Free

• Drosophila homolog)
• Drosophila)
• SFRS8
• splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog
• splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot
• Splicing factor, arginine/serine-rich 8
• splicing factor, suppressor of white-apricot homolog (Drosophila)
• splicing factor, suppressor of white-apricot homolog
• Suppressor of white apricot protein homolog
• SWAPMGC167082

Background

SFRS8 regulates the splicing of CD45, a protein which through alternative splice variants, has an essential role in activating T cells. T cells are involved in the pathogenesis of atopic diseases such as asthma, making SFRS8 a very interesting candidate gene in the region. SFRS8 could act as a weak predisposing gene for asthma. [from: http://www.ncbi.nlm.nih.gov/sites/entrez®cmd=Retrieve&db=PubMed&list_uids=16738036&dopt=Abstract] The basic functions of SFRS8 are the mediation of protein-protein interactions within the intron during spliceosome assembly, independently binding to exonic enhancer sequences, and recruiting components to adjacent introns for splice-site recognition and alternative splicing. [from: http://www.dsi.univ-paris5.fr/genatlas/fiche1.php®symbol=SFRS8]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFSWAP