SFRS5 Antibody

Images

 
Western Blot: SFRS5 Antibody [NBP1-92381] - Analysis in human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: SFRS5 Antibody [NBP1-92381] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Western Blot: SFRS5 Antibody [NBP1-92381] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human pancreas shows weak nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFRS5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE
Specificity
Specificity of human SFRS5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRSF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
SFRS5 Knockout 293T Cell Lysate
Control Peptide
SFRS5 Protein (NBP1-92381PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFRS5 Antibody

  • Delayed-early protein HRS
  • HRSSFRS5
  • serine/arginine-rich splicing factor 5
  • Splicing factor, arginine/serine-rich 5Pre-mRNA-splicing factor SRP40
  • SRP40SR splicing factor 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Pm, Pm
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
AF5708
Species: Hu
Applications: WB, ICC
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-04142
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92826
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-36568
Species: Hu, Mu
Applications: WB, IHC, IHC-P, Flow-IC
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP2-04144
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for SFRS5 Antibody (NBP1-92381) (0)

There are no publications for SFRS5 Antibody (NBP1-92381).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS5 Antibody (NBP1-92381) (0)

There are no reviews for SFRS5 Antibody (NBP1-92381). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFRS5 Antibody (NBP1-92381) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SFRS5 Products

Bioinformatics Tool for SFRS5 Antibody (NBP1-92381)

Discover related pathways, diseases and genes to SFRS5 Antibody (NBP1-92381). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFRS5 Antibody (NBP1-92381)

Discover more about diseases related to SFRS5 Antibody (NBP1-92381).
 

Pathways for SFRS5 Antibody (NBP1-92381)

View related products by pathway.

PTMs for SFRS5 Antibody (NBP1-92381)

Learn more about PTMs related to SFRS5 Antibody (NBP1-92381).

Blogs on SFRS5

There are no specific blogs for SFRS5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFRS5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF5