SFRS3 Antibody (2D2) Summary
Immunogen |
SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
Specificity |
SFRS3 (2D2) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SRSF3 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunoprecipitation
- Western Blot
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
Publications |
|
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SFRS3 Antibody (2D2)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vivo, KD, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
Publications for SFRS3 Antibody (H00006428-M08)(3)
Showing Publications 1 -
3 of 3.
Reviews for SFRS3 Antibody (H00006428-M08) (0)
There are no reviews for SFRS3 Antibody (H00006428-M08).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SFRS3 Antibody (H00006428-M08) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SFRS3 Products
Bioinformatics Tool for SFRS3 Antibody (H00006428-M08)
Discover related pathways, diseases and genes to SFRS3 Antibody (H00006428-M08). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SFRS3 Antibody (H00006428-M08)
Discover more about diseases related to SFRS3 Antibody (H00006428-M08).
| | Pathways for SFRS3 Antibody (H00006428-M08)
View related products by pathway.
|
PTMs for SFRS3 Antibody (H00006428-M08)
Learn more about PTMs related to SFRS3 Antibody (H00006428-M08).
|
Blogs on SFRS3