SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT |
| Predicted Species |
Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NR5A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free
Background
Steroidogenic factor 1 (SF-1), a NR5 Fushi Tarazu-Like Receptor, has been shown to affect sexual differentiation, steroid metabolism, and neural development. SF-1 binds as a monomer and regulates all steroidogenic p450 genes, Mullerian inhibiting substance, the gonadotrophins, the ACTH receptor, oxytocin, nuclear receptor DAX-1, and several other genes. Four alternatively spliced isoforms of SF-1 have been isolated in mice, and they differ at the N and C termini but are identical in the DNA-binding domain. SF-1 expression has been documented in human brain, adrenal, spleen, liver, heart, ovary, testis, and placenta. ESTs have been isolated from human tissue libraries, including cancerous adrenal and normal lung and testis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF
Publications for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP3-21418) (0)
There are no publications for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP3-21418).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP3-21418) (0)
There are no reviews for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP3-21418).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP3-21418) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SF-1/NR5A1/Steroidogenic Factor 1 Products
Research Areas for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP3-21418)
Find related products by research area.
|
Blogs on SF-1/NR5A1/Steroidogenic Factor 1