BRD2 Antibody

Images

 
Orthogonal Strategies: Western Blot: BRD2 Antibody [NBP1-84310] - Analysis in human cell lines HEK293 and MCF-7 using Anti-BRD2 antibody. Corresponding BRD2 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: BRD2 Antibody [NBP1-84310] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Orthogonal Strategies: Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining in human testis and liver tissues. Corresponding BRD2 RNA-seq data are presented for the same tissues.
Western Blot: BRD2 Antibody [NBP1-84310] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

BRD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP
Specificity
Specificity of human, human (negative) BRD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRD2 Protein (NBP1-84310PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRD2 Antibody

  • bromodomain containing 2
  • bromodomain-containing 2
  • bromodomain-containing protein 2
  • D6S113E
  • female sterile homeotic-related gene 1
  • FSRG1FSH
  • KIAA9001FLJ31942
  • NAT
  • O27.1.1
  • Really interesting new gene 3 protein
  • RING3DKFZp686N0336
  • RNF3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NB300-506
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00093659-P01
Species: Hu
NBP1-84310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BRD2 Antibody (NBP1-84310) (0)

There are no publications for BRD2 Antibody (NBP1-84310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRD2 Antibody (NBP1-84310) (0)

There are no reviews for BRD2 Antibody (NBP1-84310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BRD2 Antibody (NBP1-84310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRD2 Products

Bioinformatics Tool for BRD2 Antibody (NBP1-84310)

Discover related pathways, diseases and genes to BRD2 Antibody (NBP1-84310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD2 Antibody (NBP1-84310)

Discover more about diseases related to BRD2 Antibody (NBP1-84310).
 

Pathways for BRD2 Antibody (NBP1-84310)

View related products by pathway.

PTMs for BRD2 Antibody (NBP1-84310)

Learn more about PTMs related to BRD2 Antibody (NBP1-84310).

Blogs on BRD2

There are no specific blogs for BRD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD2