Immunocytochemistry/ Immunofluorescence: BRD2 Antibody [NBP1-84310] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.
Orthogonal Strategies: Analysis in human cell lines HEK293 and MCF-7 using Anti-BRD2 antibody. Corresponding BRD2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Novus Biologicals Rabbit BRD2 Antibody - BSA Free (NBP1-84310) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BRD2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for BRD2 Antibody - BSA Free
BRD2
bromodomain containing 2
bromodomain-containing 2
bromodomain-containing protein 2
D6S113E
female sterile homeotic-related gene 1
FSRG1
FSRG1FSH
KIAA9001FLJ31942
NAT
O27.1.1
Really interesting new gene 3 protein
RING3
RING3DKFZp686N0336
RNF3
Background
BRD2 (bromodomain-containing 2) is a nuclear mitogen-activated kinase that plays a role in transcription of cell-cycle-regulated genes (1). Alternate names for BRD2 include RING3, NAT, RNF3, FSRG1, D6S113E, FLJ31942, DKFZp686N0336, and KIAA9001 (2). BRD2 belongs to the BET (bromodomain/extra terminal domain) family of proteins which contain two tandem bromodomains (BDI and BDII) and an extra-terminal (ET) domain (1, 3). In mammals there are four BET paralogs (BRD2, BRD3, BRD4, and BRDT) which have a similar amino acid sequence, domain organization, and function (3). The bromodomain of BRD2 is a ~110 amino acids conserved sequence that forms 4 alpha-helices (alphaZ, alphaA, alphaB, and alphaC) and 2 loops (ZA and BC) that can bind to the acetylated lysine-12 residue of chromatin histone H4 and is required for epigenetic regulation of gene transcription (1-3). The ET is a conserved region of ~80 amino acids that recruits specific effector proteins (3). The theoretical molecular weight of BRD2 is 88 kDa but the observed band is typically ~110 kDa due to post-translational modifications. The coding region of the Brd2 gene contains 11 exons and covers over 6 kb of DNA (3). Furthermore, the gene maps to the major histocompatibility complex (MHC) class II region on chromosome 6p21.3 (2).
BRD2 and the other BET proteins have been implicated in a variety of diseases and pathologies. The BET proteins are known drivers of cancer through mutation and over-expression (1). Recently, in studies examining the role of Type 2 diabetes and obesity in breast cancer progression, the BET proteins have been shown to be critical regulators of metabolism and metastasis and are co-activators for the transcription of genes that encode pro-inflammatory cytokines in immune cells infiltrating the breast cancer microenvironment (1). Accordingly, knockdown of Brd2 in mice protected the animals from developing Type 2 diabetes and stopped the inflammatory response typically elicited by obesity (4). BRD2 is also highly expressed in the brain and the gene has been shown to play a role in juvenile myoclonic epilepsy, a common form of epilepsy that typically reveals itself during adolescence (5). In addition to the brain, BRD2 is highly expressed in the bone marrow and consequently its kinase activity has been shown to increase upon cellular proliferation and is significantly elevated in the peripheral blood lymphocytes of lymphoma patients (2, 3).
Research has been done to better understand protein interactions with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of the novel coronavirus disease 2019 (COVID-19), as possible targets for drug therapies. It was recently described that that the transmembrane envelope protein (E) of SARS-CoV-2 binds to both BRD2 and BRD4, suggesting that bromodomain inhibitors could be a potential drug target (6). More specifically, the bromodomain inhibitors could be relevant regarding the secondary immune-related consequences that arise from SARS-CoV-2 infection (6). Bromodomain inhibitors are currently the focus of multiple clinical trials as a potential therapeutic in cancer and pulmonary arterial hypertension (6).
References
1. Andrieu, G.P., Shafran, J.S., Deeney, J.T., Bharadwaj, K.R., Rangarajan, A., & Denis, G.V. (2018). BET proteins in abnormal metabolism, inflammation, and the breast cancer microenvironment. J Leukoc Biol. https://doi:10.1002/JLB.5RI0917-380RR
2. BRD2 bromodomain 2 (human), NCBI
3. Taniguchi, Y. (2016). The Bromodomain and Extra-Terminal Domain (BET) Family: Functional Anatomy of BET Paralogous Proteins. Int J Mol Sci. https://doi:10.3390/ijms17111849
4. Wang, F., Deeney, J.T., & Denis, G.V. (2013). Brd2 gene disruption causes "metabolically healthy" obesity: epigenetic and chromatin-based mechanisms that uncouple obesity from type 2 diabetes. Vitam Horm. https://doi:10.1016/B978-0-12-407766-9.00003-1
5. Gilsoul, M., Grisar, T., Delgado-Escueta, A.V., de Nijs, L., & Lakaye, B. (2019). Subtle Brain Developmental Abnormalities in the Pathogenesis of Juvenile Myoclonic Epilepsy. Front Cell Neurosci. https://doi:10.3389/fncel.2019.00433
6. Harrison, C. (2020). Drug researchers pursue new lines of attack against COVID-19. Nat Biotechnol. https://doi.org/10.1038/d41587-020-00013-z
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our BRD2 Antibody - BSA Free and receive a gift card or discount.