Serpin B6 Antibody

Images

 
Western Blot: SerpinB6 Antibody [NBP1-86643] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SerpinB6 Antibody [NBP1-86643] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin B6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINB6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serpin B6 Protein (NBP1-86643PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin B6 Antibody

  • CAP
  • CAPMGC111370
  • Cytoplasmic antiproteinase
  • deafness, autosomal recessive 91
  • DFNB91
  • Peptidase inhibitor 6
  • PI6
  • PI-6
  • PI6MSTP057
  • Placental thrombin inhibitor
  • protease inhibitor 6 (placental thrombin inhibitor)
  • PTI
  • PTIDKFZp686I04222
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6
  • Serpin B6
  • serpin peptidase inhibitor, clade B (ovalbumin), member 6
  • SPI3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5535
Species: Hu
Applications: WB, Simple Western
AF6386
Species: Hu
Applications: WB, IP
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86643
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Serpin B6 Antibody (NBP1-86643) (0)

There are no publications for Serpin B6 Antibody (NBP1-86643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin B6 Antibody (NBP1-86643) (0)

There are no reviews for Serpin B6 Antibody (NBP1-86643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin B6 Antibody (NBP1-86643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin B6 Products

Bioinformatics Tool for Serpin B6 Antibody (NBP1-86643)

Discover related pathways, diseases and genes to Serpin B6 Antibody (NBP1-86643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin B6 Antibody (NBP1-86643)

Discover more about diseases related to Serpin B6 Antibody (NBP1-86643).
 

Pathways for Serpin B6 Antibody (NBP1-86643)

View related products by pathway.

Blogs on Serpin B6

There are no specific blogs for Serpin B6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin B6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB6
Entrez