Semaphorin 6A Antibody

Images

 
Immunohistochemistry-Paraffin: Semaphorin 6A Antibody [NBP1-83155] - Staining of human small intestine shows strong granular positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Semaphorin 6A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPGNTAKMLIKADQHHLDLTAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Semaphorin 6A Protein (NBP1-83155PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Semaphorin 6A Antibody

  • KIAA1368HT018
  • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A
  • Sema VIA
  • SEMA
  • Sema6A
  • SEMA6A1
  • SEMA6A-1
  • Semaphorin 6A
  • semaphorin 6A-1
  • Semaphorin VIA
  • semaphorin-6A
  • semaphorin-6A-1
  • SEMAQ
  • VIA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-85128
Species: Hu
Applications: IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF2094
Species: Hu, Mu
Applications: WB, IHC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-82527
Species: Hu
Applications: IHC, IHC-P
MAB1728
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Semaphorin 6A Antibody (NBP1-83155) (0)

There are no publications for Semaphorin 6A Antibody (NBP1-83155).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 6A Antibody (NBP1-83155) (0)

There are no reviews for Semaphorin 6A Antibody (NBP1-83155). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Semaphorin 6A Antibody (NBP1-83155) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Semaphorin 6A Products

Bioinformatics Tool for Semaphorin 6A Antibody (NBP1-83155)

Discover related pathways, diseases and genes to Semaphorin 6A Antibody (NBP1-83155). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 6A Antibody (NBP1-83155)

Discover more about diseases related to Semaphorin 6A Antibody (NBP1-83155).
 

Pathways for Semaphorin 6A Antibody (NBP1-83155)

View related products by pathway.

PTMs for Semaphorin 6A Antibody (NBP1-83155)

Learn more about PTMs related to Semaphorin 6A Antibody (NBP1-83155).
 

Research Areas for Semaphorin 6A Antibody (NBP1-83155)

Find related products by research area.

Blogs on Semaphorin 6A

There are no specific blogs for Semaphorin 6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA6A
Entrez