Semaphorin 6A Antibody

Images

 
Western Blot: Semaphorin 6A Antibody [NBP1-69281] - This Anti-Semaphorin 6A antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Semaphorin 6A Antibody Summary

Immunogen
Synthetic peptides corresponding to SEMA6A(sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A) The peptide sequence was selected from the middle region of SEMA6A. Peptide sequence ERVPKPRPGCCAGSSSLERYATSNEFPDDT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SEMA6A and was validated on Western blot.
Theoretical MW
114 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Semaphorin 6A Antibody

  • KIAA1368HT018
  • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A
  • Sema VIA
  • SEMA
  • Sema6A
  • SEMA6A1
  • SEMA6A-1
  • Semaphorin 6A
  • semaphorin 6A-1
  • Semaphorin VIA
  • semaphorin-6A
  • semaphorin-6A-1
  • SEMAQ
  • VIA

Background

SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-85128
Species: Hu
Applications: IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF2094
Species: Hu, Mu
Applications: WB, IHC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-82527
Species: Hu
Applications: IHC, IHC-P
MAB1728
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Semaphorin 6A Antibody (NBP1-69281) (0)

There are no publications for Semaphorin 6A Antibody (NBP1-69281).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 6A Antibody (NBP1-69281) (0)

There are no reviews for Semaphorin 6A Antibody (NBP1-69281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 6A Antibody (NBP1-69281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Semaphorin 6A Products

Bioinformatics Tool for Semaphorin 6A Antibody (NBP1-69281)

Discover related pathways, diseases and genes to Semaphorin 6A Antibody (NBP1-69281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 6A Antibody (NBP1-69281)

Discover more about diseases related to Semaphorin 6A Antibody (NBP1-69281).
 

Pathways for Semaphorin 6A Antibody (NBP1-69281)

View related products by pathway.

PTMs for Semaphorin 6A Antibody (NBP1-69281)

Learn more about PTMs related to Semaphorin 6A Antibody (NBP1-69281).
 

Research Areas for Semaphorin 6A Antibody (NBP1-69281)

Find related products by research area.

Blogs on Semaphorin 6A

There are no specific blogs for Semaphorin 6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA6A
Entrez
Uniprot