Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI |
Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PLXNA4 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | Use in WB reported in scientific literature (PMID:34017863). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Ray A.M. Daza - RF Hevner Lab |
Immunohistochemistry-Frozen | Mouse | 04/25/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for Plexin A4 Antibody (NBP1-85128)Discover more about diseases related to Plexin A4 Antibody (NBP1-85128).
| Pathways for Plexin A4 Antibody (NBP1-85128)View related products by pathway.
|
PTMs for Plexin A4 Antibody (NBP1-85128)Learn more about PTMs related to Plexin A4 Antibody (NBP1-85128).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Ray A.M. Daza - RF Hevner Lab 04/25/2013 |
||
Application: | Immunohistochemistry-Frozen | |
Species: | Mouse |
Gene Symbol | PLXNA4 |