Plexin A4 Antibody

Images

 
Immunohistochemistry-Paraffin: Plexin A4 Antibody [NBP1-85128] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plexin A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
Specificity
Specificity of human Plexin A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLXNA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Plexin A4 Protein (NBP1-85128PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85128 in the following applications:

Publications
Read Publications using
NBP1-85128 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30735130).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plexin A4 Antibody

  • A
  • DKFZp434G0625
  • FAYV2820
  • FLJ35026
  • FLJ38287
  • KIAA1550DKFZp566O0546
  • PLEXA4
  • Plexin A4
  • plexin A4, B
  • plexin-A4
  • PLXNA4
  • PLXNA4A
  • PLXNA4B
  • PRO34003

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4075
Species: Mu, Rt
Applications: WB, IHC
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF1146
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF2215
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
NBP1-91480
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00004745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2094
Species: Hu, Mu
Applications: WB, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-82527
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Plexin A4 Antibody (NBP1-85128)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for Plexin A4 Antibody (NBP1-85128) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85128:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Plexin A4 NBP1-85128
Enlarge
5
reviewed by:
Anonymous
IHC-Fr Mouse 04/25/2013
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample Testedmouse brain
SpeciesMouse
LotR30914
CommentsI also tried at 1:200 and works at that dilution.

Blocking

Blocking Details30 minutes with Normal Goat Serum, 3% BSA, and 0.01% Triton-X in 1x PBS (PBST)

Primary Anitbody

Dilution Ratio1:100 at 4degreesC in a humidified chamber, overnight in PBST

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, Alexa 568 (Life Technologies)
Secondary Manufacturer Cat#A11011
Secondary Concentration1:400

Details

Detection NotesImmunoflourescence, Zeiss Axio Imager
Fixation DetailsAntigen Retrieval, Sodium Citrate pH 6.0
Wash Description3x for 8 minutes in 1x PBS

Comments

CommentsI also tried at 1:200 and works at that dilution.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Plexin A4 Antibody (NBP1-85128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Plexin A4 Products

Bioinformatics Tool for Plexin A4 Antibody (NBP1-85128)

Discover related pathways, diseases and genes to Plexin A4 Antibody (NBP1-85128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plexin A4 Antibody (NBP1-85128)

Discover more about diseases related to Plexin A4 Antibody (NBP1-85128).
 

Pathways for Plexin A4 Antibody (NBP1-85128)

View related products by pathway.

PTMs for Plexin A4 Antibody (NBP1-85128)

Learn more about PTMs related to Plexin A4 Antibody (NBP1-85128).

Blogs on Plexin A4

There are no specific blogs for Plexin A4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
04/25/2013
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol PLXNA4