Home » Plexin A4 » Plexin A4 Antibodies » Plexin A4 Antibody

Plexin A4 Antibody

 (3 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Plexin A4 Antibody [NBP1-85128] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Plexin A4 Antibody [NBP1-85128] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Plexin A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLXNA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot
Application Notes
Use in WB reported in scientific literature (PMID:34017863). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Plexin A4 Protein (NBP1-85128PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85128 in the following applications:
Publications
Read Publications using
NBP1-85128 in the following applications:

  • IHC-P
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30735130).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plexin A4 Antibody

  • A
  • DKFZp434G0625
  • FAYV2820
  • FLJ35026
  • FLJ38287
  • KIAA1550DKFZp566O0546
  • PLEXA4
  • Plexin A4
  • plexin A4, B
  • plexin-A4
  • PLXNA4
  • PLXNA4A
  • PLXNA4B
  • PRO34003

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Semaphorin 3A
[Unconjugated]
1250-S3
RecombinantHuman Semaphorin 3A Fc Chimera binds to Recombinant Rat Neuropilin-1 Fc Chimerain an ELISA Binding Assay. When Recombinant Rat Neuropilin‑1 Fc Chimera (Catalog # 566-N1) is coated at 2µg/ml, Recombinant Human Semaphorin 3A Fc Chimera (Catalog # 1250-S3) binds with anED50= 50-300 ng/mL.
(2 Reviews)
(32 Publications)
Species: Hu
Applications: BA, BA
Plexin A3 Antibody
[Unconjugated]
AF4075
Plexin A3 was detected in immersion fixed frozen sections of embryonic rat spinal cord using Goat Anti-Mouse Plexin A3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4075) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Plexin A3 was detected in immersion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Plexin A3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4075) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Publications)
Species: Mu, Rt
Applications: IHC, WB
Neuropilin-1
Antibody [Unconjugate
AF566
Neuropilin‑1 was detected in immersion fixed paraffin-embedded sections of rat brain (hippocampus) using Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neuronal cell bodies and projections. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Neuropilin‑1 was detected in immersion fixed paraffin-embedded sections of rat brain (thalamus) using Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neuronal cell bodies and projections. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Western blot shows 25 ng of Recombinant Mouse Neuropilin‑1 (Catalog # 5994-N1), Recombinant Rat Neuropilin‑1 Fc Chimera (Catalog # 566-N1) and Recombinant Human Neuropilin‑1 (Catalog # 3870-N1). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Neuropilin‑1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(12 Reviews)
(50 Publications)
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Semaphorin 6A
Antibody [Unconjugate
AF1146
Semaphorin 6A Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Plexin A2 Antibody
[Unconjugated]
AF5486
Plexin A2 was detected in immersion fixed bEnd.3 mouse endothelioma cell line using Goat Anti-Human/Mouse/Rat Plexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5486) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Plexin A2 was detected in immersion fixed HUVEC human umbilical vein endothelial cells using Goat Anti-Human/Mouse/Rat Plexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5486) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of bEnd.3 mouse endothelioma cell line, loaded at 0.2 mg/mL. A specific band was detected for Plexin A2 at approximately 246 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat Plexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5486) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Plexin A1 Antibody
[Unconjugated]
AF4309
Plexin A1 was detected in immersion fixed frozen sections of embryonic mouse spinal cord using Mouse Plexin A1 Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Plexin A1 was detected in immersion fixed immature human dendritic cells using Goat Anti-Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of mouse embryonic heart tissue. PVDF Membrane was probed with 1 µg/mL of Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A1 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(5 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Neuropilin-2
Antibody [Unconjugate
AF2215
Neuropilin‑2 was detected in immersion fixed paraffin-embedded sections of human pancreatic cancer tissue using Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF2215) at 5 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HUVEC human umbilical vein endothelial cells. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2215) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Neuropilin‑2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HUVEC human umbilical vein endothelial cells, C6 rat glioma cell line, LL/2 mouse Lewis lung carcinoma cell line, and bEnd.3 mouse endothelioma cell line, loaded at 0.2 mg/mL. A specific band was detected for Neuropilin‑2 at approximately 140 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2215) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, Simple Western, WB
Semaphorin 3F
[Unconjugated]
3237-S3
Semaphorin 3F [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: BA
VEGF [HRP]
DVE00
(26 Reviews)
(600 Publications)
Species: Hu
Applications: ELISA
NELL1 Antibody
AF7109
Western blot shows lysates of Neuro‑2A mouse neuroblastoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse NELL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7109) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for NELL1 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NELL1 was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Sheep Anti-Mouse NELL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7109) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neurons in the spinal cord. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: IHC, WB
GAL3ST1 Antibody
H00009514-B01P
Western Blot: GAL3ST1 Antibody [H00009514-B01P] - Analysis of GAL3ST1 expression in transfected 293T cell line by GAL3ST1 polyclonal antibody. Lane1:GAL3ST1 transfected lysate(46.53 KDa). Lane2:Non-transfected lysate.
(3 Publications)
Species: Hu, Mu
Applications: WB
CASZ1 Antibody
NBP1-86617
Immunohistochemistry-Paraffin: CASZ1 Antibody [NBP1-86617] - Staining of human skin shows strong nuclear positivity in stratum granulosum.
Immunocytochemistry/Immunofluorescence: CASZ1 Antibody [NBP1-86617] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Semaphorin 6B
Antibody
AF2094
Semaphorin 6B Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, WB
Recombinant Human
SLC35A1 GST (N-Term) ...
H00010559-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord (ventral horn) using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(173 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(451 Publications)
Species: Hu
Applications: BA
NELL2 Antibody
NBP1-82527
Immunohistochemistry: NELL2 Antibody [NBP1-82527] - NELL2 expression in the 3% PFA perfused mouse brain Hippocampus and Cortex using primary antibody with 1:100 dilution. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human placenta shows very weak cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Semaphorin 3A
[Unconjugated]
1250-S3
RecombinantHuman Semaphorin 3A Fc Chimera binds to Recombinant Rat Neuropilin-1 Fc Chimerain an ELISA Binding Assay. When Recombinant Rat Neuropilin‑1 Fc Chimera (Catalog # 566-N1) is coated at 2µg/ml, Recombinant Human Semaphorin 3A Fc Chimera (Catalog # 1250-S3) binds with anED50= 50-300 ng/mL.
(2 Reviews)
(32 Publications)
Species: Hu
Applications: BA, BA

Publications for Plexin A4 Antibody (NBP1-85128)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Review for Plexin A4 Antibody (NBP1-85128) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85128:
Filter by Applications
Immunohistochemistry-Frozen
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Plexin A4 NBP1-85128
Enlarge 		5
reviewed by:
Ray A.M. Daza - RF Hevner Lab
 Immunohistochemistry-Frozen Mouse 04/25/2013
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample Testedmouse brain
SpeciesMouse
LotR30914

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plexin A4 Antibody (NBP1-85128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plexin A4 Products

Bioinformatics Tool for Plexin A4 Antibody (NBP1-85128)

Discover related pathways, diseases and genes to Plexin A4 Antibody (NBP1-85128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plexin A4 Antibody (NBP1-85128)

Discover more about diseases related to Plexin A4 Antibody (NBP1-85128).
 

Pathways for Plexin A4 Antibody (NBP1-85128)

View related products by pathway.

PTMs for Plexin A4 Antibody (NBP1-85128)

Learn more about PTMs related to Plexin A4 Antibody (NBP1-85128).

Blogs on Plexin A4

There are no specific blogs for Plexin A4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Frozen Plexin A4 NBP1-85128
Enlarge
 Ray A.M. Daza - RF Hevner Lab
04/25/2013
Application: Immunohistochemistry-Frozen
Species: Mouse
read this review

Bioinformatics

Gene Symbol PLXNA4