Plexin A4 Antibody

Images

 
Immunohistochemistry-Paraffin: Plexin A4 Antibody [NBP1-85128] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plexin A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLXNA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot -Reported in scientific literature (PMID:34017863)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Plexin A4 Protein (NBP1-85128PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85128 in the following applications:

Publications
Read Publications using
NBP1-85128 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30735130).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plexin A4 Antibody

  • A
  • DKFZp434G0625
  • FAYV2820
  • FLJ35026
  • FLJ38287
  • KIAA1550DKFZp566O0546
  • PLEXA4
  • Plexin A4
  • plexin A4, B
  • plexin-A4
  • PLXNA4
  • PLXNA4A
  • PLXNA4B
  • PRO34003

Background

Forms a receptor complex with neuropilin-1 and can propagate semaphorin-3A elicited inhibitory signals intocells and neurons

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Plexin A4 Antibody (NBP1-85128)(3)

Review for Plexin A4 Antibody (NBP1-85128) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85128:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Plexin A4 NBP1-85128
Enlarge
5
reviewed by:
Verified Customer
IHC-Fr Mouse 04/25/2013
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample Testedmouse brain
SpeciesMouse
LotR30914

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plexin A4 Antibody (NBP1-85128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
04/25/2013
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol PLXNA4