Secretagogin Antibody - BSA Free

Immunohistochemistry-Paraffin: Secretagogin Antibody [NBP1-88219] - Staining in human pancreas and fallopian tube tissues using NBP1-88219 antibody. Corresponding SCGN RNA-seq data are presented for the same tissues.

Immunohistochemistry: Secretagogin Antibody [NBP1-88219] - Staining of mouse olfactory bulb, glomerular layer shows nuclear positivity.

Immunohistochemistry-Paraffin: Secretagogin Antibody [NBP1-88219] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.

Immunohistochemistry-Paraffin: Secretagogin Antibody [NBP1-88219] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Secretagogin Antibody [NBP1-88219] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: Secretagogin Antibody [NBP1-88219] - Staining of human rectum shows strong cytoplasmic positivity in peripheral nerve / ganglion.

Immunohistochemistry: Secretagogin Antibody [NBP1-88219] - Staining of mouse brain shows positivity in fasciola cinereum.

Immunohistochemistry: Secretagogin Antibody [NBP1-88219] - Staining of mouse hypothalamus shows positivity in the paraventricular hypothalamic nucleus.

Analysis in human cerebellum tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Secretagogin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCGN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Secretagogin Protein (NBP1-88219PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Secretagogin Antibody - BSA Free

• CALBL
• DJ501N12.8
• SCGN
• SECRET
• Secretagogin
• secretagogin, EF-hand calcium binding protein
• SECRETsecretagogin
• SEGN
• Setagin

Background

The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Secretagogin Antibody (NBP1-88219)(8)

Publications using NBP1-88219

• Zhang MD, Tortoriello G, Hsueh B et al. Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury. Proc Natl Acad Sci U S A 2014-03-25 [PMID: 24616509]
• Gyengesi E, Andrews ZB, Paxinos G et al. Distribution of secretagogin-containing neurons in the basal forebrain of mice, with special reference to the cholinergic corticopetal system. Brain Res Bull 2013-05-01 [PMID: 23376788] (ICC/IF, Mouse)
• Attems J, Alpar A, Spence L et al. Clusters of secretagogin-expressing neurons in the aged human olfactory tract lack terminal differentiation. Proc Natl Acad Sci U S A 2012-04-17 [PMID: 22474393]
• Lindskog C, Korsgren O, Ponten F et al. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. J Proteomics 2012-05-17 [PMID: 22465717]
• Alpar A, Attems J, Mulder J et al. The renaissance of Ca2+-binding proteins in the nervous system: secretagogin takes center stage. Cell Signal 2012-02-01 [PMID: 21982882]
• Mulder J, Spence L, Tortoriello G et al. Secretagogin is a Ca2+-binding protein identifying prospective extended amygdala neurons in the developing mammalian telencephalon. Eur J Neurosci 2010-06-01 [PMID: 20529129]
• Mulder J, Zilberter M, Spence L et al. Secretagogin is a Ca2+-binding protein specifying subpopulations of telencephalic neurons. Proc Natl Acad Sci U S A 2009-12-29 [PMID: 20018755]
• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Bioinformatics

• Gene Symbol: SCGN
• Entrez:
  • 10590(Human)
• Uniprot:
  • O76038(Human)