Secretagogin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Secretagogin Antibody [NBP1-88219] - Staining human cerebellum shows strong immunoreactivity in the molecular layer neurons.
Immunohistochemistry: Secretagogin Antibody [NBP1-88219] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.
Immunocytochemistry/ Immunofluorescence: Secretagogin Antibody [NBP1-88219] - Staining mouse hypothalamus shows selective positivity in the periventricular nucleus.
Immunocytochemistry/ Immunofluorescence: Secretagogin Antibody [NBP1-88219] - Staining mouse septohippocampal nucleus shows labeling of neuronal cell bodies and processes.
Immunocytochemistry/ Immunofluorescence: Secretagogin Antibody [NBP1-88219] - Staining mouse brain shows selective immunoreactivity in fasciola cinerera.
Immunohistochemistry: Secretagogin Antibody [NBP1-88219] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.
Immunohistochemistry: Secretagogin Antibody [NBP1-88219] - Staining of human hippocampus shows strong positivity in subsets of neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Secretagogin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Secretagogin Protein (NBP1-88219PEP)
Publications
Read Publications using
NBP1-88219 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19351664)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Secretagogin Antibody

  • CALBL
  • DJ501N12.8
  • SCGN
  • SECRET
  • Secretagogin
  • secretagogin, EF-hand calcium binding protein
  • SECRETsecretagogin
  • SEGN
  • Setagin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB6237
Species: Hu
Applications: WB, IHC
NBP1-88219
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Secretagogin Antibody (NBP1-88219)(8)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-88219 Applications Species
Zhang MD, Tortoriello G, Hsueh B et al. Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury. Proc Natl Acad Sci U S A 2014 Mar 25 [PMID: 24616509]
Gyengesi E, Andrews ZB, Paxinos G et al. Distribution of secretagogin-containing neurons in the basal forebrain of mice, with special reference to the cholinergic corticopetal system. Brain Res Bull 2013 May [PMID: 23376788] (ICC/IF, Mouse) ICC/IF Mouse
Attems J, Alpar A, Spence L et al. Clusters of secretagogin-expressing neurons in the aged human olfactory tract lack terminal differentiation. Proc Natl Acad Sci U S A 2012 Apr 17 [PMID: 22474393]
Lindskog C, Korsgren O, Ponten F et al. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. J Proteomics 2012 May 17 [PMID: 22465717]
Alpar A, Attems J, Mulder J et al. The renaissance of Ca2+-binding proteins in the nervous system: secretagogin takes center stage. Cell Signal 2012 Feb [PMID: 21982882]
Mulder J, Spence L, Tortoriello G et al. Secretagogin is a Ca2+-binding protein identifying prospective extended amygdala neurons in the developing mammalian telencephalon. Eur J Neurosci 2010 Jun [PMID: 20529129]
Mulder J, Zilberter M, Spence L et al. Secretagogin is a Ca2+-binding protein specifying subpopulations of telencephalic neurons. Proc Natl Acad Sci U S A 2009 Dec 29 [PMID: 20018755]
Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009 Jul [PMID: 19351664]

Reviews for Secretagogin Antibody (NBP1-88219) (0)

There are no reviews for Secretagogin Antibody (NBP1-88219). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Secretagogin Antibody (NBP1-88219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Secretagogin Products

Bioinformatics Tool for Secretagogin Antibody (NBP1-88219)

Discover related pathways, diseases and genes to Secretagogin Antibody (NBP1-88219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secretagogin Antibody (NBP1-88219)

Discover more about diseases related to Secretagogin Antibody (NBP1-88219).
 

Pathways for Secretagogin Antibody (NBP1-88219)

View related products by pathway.

PTMs for Secretagogin Antibody (NBP1-88219)

Learn more about PTMs related to Secretagogin Antibody (NBP1-88219).

Blogs on Secretagogin

There are no specific blogs for Secretagogin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Secretagogin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCGN
Entrez
Uniprot