SEC24A Antibody

Images

 
Immunohistochemistry: SEC24A Antibody [NBP1-85867] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC24A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPSLQNSFIKSGPSVPPLVNPPLPTTFQPGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC24A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEC24A Protein (NBP1-85867PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC24A Antibody

  • member A
  • protein transport protein Sec24A
  • SEC24 family, member A (S. cerevisiae)
  • SEC24-related protein A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009871-M04
Species: Hu
Applications: WB, ELISA
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011236-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
1407-PI
Species: Hu
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01828
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP

Publications for SEC24A Antibody (NBP1-85867) (0)

There are no publications for SEC24A Antibody (NBP1-85867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC24A Antibody (NBP1-85867) (0)

There are no reviews for SEC24A Antibody (NBP1-85867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEC24A Antibody (NBP1-85867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC24A Products

Bioinformatics Tool for SEC24A Antibody (NBP1-85867)

Discover related pathways, diseases and genes to SEC24A Antibody (NBP1-85867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC24A Antibody (NBP1-85867)

Discover more about diseases related to SEC24A Antibody (NBP1-85867).
 

Pathways for SEC24A Antibody (NBP1-85867)

View related products by pathway.

PTMs for SEC24A Antibody (NBP1-85867)

Learn more about PTMs related to SEC24A Antibody (NBP1-85867).

Blogs on SEC24A

There are no specific blogs for SEC24A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC24A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC24A