SEC24C Antibody

Images

 
Independent Antibodies: Western Blot: SEC24C Antibody [NBP1-81550] - Analysis using Anti-SEC24C antibody NBP1-81550 (A) shows similar pattern to independent antibody NBP1-81549 (B).
Immunocytochemistry/ Immunofluorescence: SEC24C Antibody [NBP1-81550] - Staining of human cell line U-251 MG shows localization to nucleoplasm and vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SEC24C Antibody [NBP1-81550] - Staining of human stomach, lower shows moderate granular cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Western Blot: SEC24C Antibody [NBP1-81550] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC24C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLPSMTGPLLPGQSFGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPYPAAPTF
Specificity
Specificity of human SEC24C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC24C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEC24C Protein (NBP1-81550PEP)
Publications
Read Publications using
NBP1-81550 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC24C Antibody

  • KIAA0079SEC24-related protein C
  • protein transport protein Sec24C
  • SEC24 (S. cerevisiae) related gene family, member C
  • SEC24 family, member C (S. cerevisiae)
  • SEC24 related gene family, member C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009871-M04
Species: Hu, Ca
Applications: WB, ELISA, IP
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-85867
Species: Hu
Applications: WB, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03381
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP2-20261
Species: Hu
Applications: WB, ICC/IF
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-89301
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92275
Species: Hu
Applications: IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-91348
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P

Publications for SEC24C Antibody (NBP1-81550)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SEC24C Antibody (NBP1-81550) (0)

There are no reviews for SEC24C Antibody (NBP1-81550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SEC24C Antibody (NBP1-81550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SEC24C Products

Bioinformatics Tool for SEC24C Antibody (NBP1-81550)

Discover related pathways, diseases and genes to SEC24C Antibody (NBP1-81550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC24C Antibody (NBP1-81550)

Discover more about diseases related to SEC24C Antibody (NBP1-81550).
 

Pathways for SEC24C Antibody (NBP1-81550)

View related products by pathway.

Blogs on SEC24C

There are no specific blogs for SEC24C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC24C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC24C