Cystatin A Antibody

Images

 
Genetic Strategies: Western Blot: Cystatin A Antibody [NBP1-86989] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is ...read more
Immunocytochemistry/ Immunofluorescence: Cystatin A Antibody [NBP1-86989] - Staining of human cell line hTCEpi shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: Cystatin A Antibody [NBP1-86989] - Staining of human skin shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Western Blot: Cystatin A Antibody [NBP1-86989] - Analysis in human esophagus tissue.
Immunocytochemistry/ Immunofluorescence: Cystatin A Antibody [NBP1-86989] - Staining of human cell line U-2 OS shows positivity in nucleus and cytoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Cystatin A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSTA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cystatin A Protein (NBP1-86989PEP)
Publications
Read Publications using NBP1-86989.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cystatin A Antibody

  • AREI
  • CSTA
  • cystatin A (stefin A)
  • Cystatin A
  • cystatin AS
  • cystatin-A
  • Stefin A
  • STF1
  • STF1Cystatin-AS
  • STFA
  • STFAStefin-A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86989
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF953
Species: Hu
Applications: IHC, IP, KO, Simple Western, WB
AF1408
Species: Hu, Rt
Applications: IHC, IP, KO, Simple Western, WB
MSCTC0
Species: Mu, Rt
Applications: ELISA
AF1013
Species: Mu
Applications: IHC, IP, WB
DKK300
Species: Hu
Applications: ELISA
AF1286
Species: Hu
Applications: IHC, IP, Simple Western, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-34062
Species: Hu
Applications: IHC, IHC-P, WB
AF2419
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB

Publications for Cystatin A Antibody (NBP1-86989)(2)

Reviews for Cystatin A Antibody (NBP1-86989) (0)

There are no reviews for Cystatin A Antibody (NBP1-86989). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cystatin A Antibody (NBP1-86989) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin A Products

Bioinformatics Tool for Cystatin A Antibody (NBP1-86989)

Discover related pathways, diseases and genes to Cystatin A Antibody (NBP1-86989). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin A Antibody (NBP1-86989)

Discover more about diseases related to Cystatin A Antibody (NBP1-86989).
 

Pathways for Cystatin A Antibody (NBP1-86989)

View related products by pathway.

PTMs for Cystatin A Antibody (NBP1-86989)

Learn more about PTMs related to Cystatin A Antibody (NBP1-86989).
 

Research Areas for Cystatin A Antibody (NBP1-86989)

Find related products by research area.

Blogs on Cystatin A

There are no specific blogs for Cystatin A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSTA