SCLT1 Antibody

Images

 
Western Blot: SCLT1 Antibody [NBP1-93891] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: SCLT1 Antibody [NBP1-93891] - Staining of human duodenum shows strong cytoplasmic positivity, with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCLT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE
Specificity
Specificity of human SCLT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCLT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCLT1 Protein (NBP1-93891PEP)
Publications
Read Publication using NBP1-93891.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25246616)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCLT1 Antibody

  • FLJ36042
  • MGC70542
  • sodium channel and clathrin linker 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004068-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-47288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-84128
Species: Hu
Applications: WB
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP1-88498
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
AF5588
Species: Hu, Mu
Applications: WB, IHC
NBP1-81257
Species: Hu
Applications: WB, IHC, IHC-P
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65887
Species: Hu
Applications: Flow, IP
NBP1-85064
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93891
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCLT1 Antibody (NBP1-93891)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for SCLT1 Antibody (NBP1-93891) (0)

There are no reviews for SCLT1 Antibody (NBP1-93891). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCLT1 Antibody (NBP1-93891) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SCLT1 Products

Array NBP1-93891

Bioinformatics Tool for SCLT1 Antibody (NBP1-93891)

Discover related pathways, diseases and genes to SCLT1 Antibody (NBP1-93891). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SCLT1

There are no specific blogs for SCLT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCLT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCLT1