SCLT1 Antibody

Western Blot: SCLT1 Antibody [NBP1-93891] - Analysis in human cell line SCLC-21H.

Immunohistochemistry-Paraffin: SCLT1 Antibody [NBP1-93891] - Staining of human duodenum shows strong cytoplasmic positivity, with a granular pattern in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SCLT1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCLT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SCLT1 Protein (NBP1-93891PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25246616)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SCLT1 Antibody

• FLJ36042
• MGC70542
• sodium channel and clathrin linker 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SCLT1 Antibody (NBP1-93891)(1)

Publication using NBP1-93891

• Kong D, Farmer V, Shukla A et al. Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles. J Cell Biol 2014-09-29 [PMID: 25246616] (IHC)

Bioinformatics

• Gene Symbol: SCLT1