GFM1 Antibody - BSA Free

Western Blot: GFM1 Antibody [NBP2-38221] - Analysis using Anti-GFM1 antibody NBP2-38221 (A) shows similar pattern to independent antibody NBP1-83997 (B).

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry: GFM1 Antibody [NBP2-38221] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining in human placenta and pancreas tissues using anti-GFM1 antibody. Corresponding GFM1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human colon.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human lymph node.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human kidney.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human testis.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human kidney, placenta, stomach and testis using Anti-GFM1 antibody NBP2-38221 (A) shows similar protein distribution across tissues to independent antibody NBP1-83997 (B).

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GFM1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GFM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GFM1 Protein (NBP2-38221PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GFM1 Antibody - BSA Free

• EFG
• EFG1FLJ12662
• EFGM
• EF-Gmt
• EGF1
• FLJ13632
• FLJ20773
• G elongation factor, mitochondrial 1
• G translation elongation factor, mitochondrial
• GFMCOXPD1
• hEFG1
• mEF-G 1
• mitochondrial elongation factor G
• mitochondrial elongation factor G1
• mitochondrial

Background

The GFM1 gene codes for a mitochondrial translation elongation factor G where one isoform is 751 amino acids long at around 83 kDA and another isoform is 770 amino acids in length at around 86 kDA. Mitochondrial translation is critical for maintaining mitochondrial function. Mutations may lead to a failure of the respiratory chain-oxidative phosphorylation system and maintenance of mitochondrial DNA will not be successful. GFM1 has been studied in relation to candidiasis, malaria, mycobacterium tuberculosis, hemophilia B, pneumonia, and combined oxidative phosphorylation deficiency. It interacts with TRIM63, SLX4, PRPF4, TRIM55, and SMURF2 to participate in protein biosynthesis and polypeptide chain elongation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GFM1
• Uniprot:
  • Q96RP9(Human)