SC35 Antibody - BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SC35 (NP_001182356.1). MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHH |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SRSF2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.09% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for SC35 Antibody - BSA Free
Background
SC35 is involved in pre-mRNA splicing and is found in the bodies in the nucleus referred to as speckles, SC 35 domains or splicing factor compartments (SFCs). The SC-35 clone is frequently used as a marker for these bodies, the role of which is controversial. Speckles correspond largely if not entirely to ultrastructures termed interchromatin granule clusters (IGCs). SC35 is excluded from the nucleolus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SC35 Antibody (NBP2-94309) (0)
There are no publications for SC35 Antibody (NBP2-94309).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SC35 Antibody (NBP2-94309) (0)
There are no reviews for SC35 Antibody (NBP2-94309).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SC35 Antibody (NBP2-94309) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SC35 Products
Blogs on SC35