FUSIP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FUSIP1 Antibody [NBP2-46818] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818] - Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FUSIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS
Specificity
Specificity of human FUSIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRSF10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FUSIP1 Recombinant Protein Antigen (NBP2-46818PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FUSIP1 Antibody

  • 40 kDa SR-repressor protein
  • FLJ43846
  • FUS interacting protein (serine-arginine rich) 1
  • FUS-interacting protein (serine-arginine rich) 2
  • FUS-interacting serine-arginine-rich protein 1
  • FUSIP1DKFZp686H0644
  • FUSIP2
  • neural-salient SR protein
  • NSSR
  • serine/arginine-rich splicing factor 10
  • serine-arginine repressor protein (40 kDa)
  • SFRS13
  • SFRS13A
  • Splicing factor SRp38
  • splicing factor, arginine/serine-rich 13
  • Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
  • SR splicing factor 10
  • SRp38
  • SRrp40TLS-associated protein with SR repeats
  • TASR1TLS-associated SR protein
  • TASR2FUS interacting protein (serine/arginine-rich) 1
  • TASRFLJ30749
  • TLS-associated protein TASR
  • TLS-associated serine-arginine protein 1
  • TLS-associated serine-arginine protein 2
  • TLS-associated serine-arginine protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-34152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86191
Species: Hu
Applications: ICC/IF
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FUSIP1 Antibody (NBP2-46818) (0)

There are no publications for FUSIP1 Antibody (NBP2-46818).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUSIP1 Antibody (NBP2-46818) (0)

There are no reviews for FUSIP1 Antibody (NBP2-46818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FUSIP1 Antibody (NBP2-46818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FUSIP1 Antibody (NBP2-46818)

Discover related pathways, diseases and genes to FUSIP1 Antibody (NBP2-46818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUSIP1 Antibody (NBP2-46818)

Discover more about diseases related to FUSIP1 Antibody (NBP2-46818).
 

Pathways for FUSIP1 Antibody (NBP2-46818)

View related products by pathway.

PTMs for FUSIP1 Antibody (NBP2-46818)

Learn more about PTMs related to FUSIP1 Antibody (NBP2-46818).
 

Research Areas for FUSIP1 Antibody (NBP2-46818)

Find related products by research area.

Blogs on FUSIP1

There are no specific blogs for FUSIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUSIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF10
Entrez
Uniprot