FUSIP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FUSIP1 Antibody [NBP2-46818] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Immunohistochemistry: FUSIP1 Antibody [NBP2-46818] - Staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.

Immunocytochemistry/Immunofluorescence: FUSIP1 Antibody [NBP2-46818] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818] - Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818] - Staining of human endometrium shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FUSIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FUSIP1 Antibody - BSA Free (NBP2-46818) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRSF10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FUSIP1 Recombinant Protein Antigen (NBP2-46818PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FUSIP1 Antibody - BSA Free

• 40 kDa SR-repressor protein
• FLJ43846
• FUS interacting protein (serine-arginine rich) 1
• FUS-interacting protein (serine-arginine rich) 2
• FUS-interacting serine-arginine-rich protein 1
• FUSIP1DKFZp686H0644
• FUSIP2
• neural-salient SR protein
• NSSR
• serine/arginine-rich splicing factor 10
• serine-arginine repressor protein (40 kDa)
• SFRS13
• SFRS13A
• Splicing factor SRp38
• splicing factor, arginine/serine-rich 13
• Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
• SR splicing factor 10
• SRp38
• SRrp40TLS-associated protein with SR repeats
• TASR1TLS-associated SR protein
• TASR2FUS interacting protein (serine/arginine-rich) 1
• TASRFLJ30749
• TLS-associated protein TASR
• TLS-associated serine-arginine protein 1
• TLS-associated serine-arginine protein 2
• TLS-associated serine-arginine protein

Background

FUSIP1 product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRSF10
• Entrez:
  • 10772(Human)
• Uniprot:
  • O75494(Human)