FUSIP1 Antibody (1G11)

Images

 
Western Blot: FUSIP1 Antibody (1G11) [H00010772-M07] - Analysis in Hela cells. From verified customer review.
Immunocytochemistry/ Immunofluorescence: FUSIP1 Antibody (1G11) [H00010772-M07] - Analysis of monoclonal antibody to FUSIP1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: FUSIP1 Antibody (1G11) [H00010772-M07] - Analysis of FUSIP1 expression in Jurkat (Cat # L017V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FUSIP1 Antibody (1G11) Summary

Immunogen
FUSIP1 (AAH05039, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE
Specificity
FUSIP1 - FUS interacting protein (serine/arginine-rich) 1 (1G11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SRSF10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Reviewed Applications
Read 1 Review rated 5
using
H00010772-M07 in the following applications:

Publications
Read Publication using
H00010772-M07 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FUSIP1 Antibody (1G11)

  • 40 kDa SR-repressor protein
  • FLJ43846
  • FUS interacting protein (serine-arginine rich) 1
  • FUS-interacting protein (serine-arginine rich) 2
  • FUS-interacting serine-arginine-rich protein 1
  • FUSIP1DKFZp686H0644
  • FUSIP2
  • neural-salient SR protein
  • NSSR
  • serine/arginine-rich splicing factor 10
  • serine-arginine repressor protein (40 kDa)
  • SFRS13
  • SFRS13A
  • Splicing factor SRp38
  • splicing factor, arginine/serine-rich 13
  • Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
  • SR splicing factor 10
  • SRp38
  • SRrp40TLS-associated protein with SR repeats
  • TASR1TLS-associated SR protein
  • TASR2FUS interacting protein (serine/arginine-rich) 1
  • TASRFLJ30749
  • TLS-associated protein TASR
  • TLS-associated serine-arginine protein 1
  • TLS-associated serine-arginine protein 2
  • TLS-associated serine-arginine protein

Background

This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66861
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6387
Species: Hu
Applications: WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010921-M05
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-75477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
H00006428-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP2-34152
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45267
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-04502
Species: Hu
Applications: ICC/IF, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-84416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for FUSIP1 Antibody (H00010772-M07)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for FUSIP1 Antibody (H00010772-M07) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00010772-M07:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FUSIP1 H00010772-M07
Enlarge
5
reviewed by:
Verified Customer
Western Blot Human 10/10/2018
View

Summary

ApplicationWestern Blot
Sample TestedHela whole cell lysate
SpeciesHuman
LotH1231-1G11

Comments

CommentsTransferred in PVDF, blocked in 5% milk-TBST for an hour at RT, 3 quick washes, incubated in Ms-anti FUSIP1 antibody at 1:1000 dilution in 1X TBST overnight at 4 degrees in a shaker, three 5 min washes in 1X TBST, incubated in anti-Ms secondary conjugated to HRP at 1:5000 dilution in 1X TBST for an hour at RT, three 5 min washes in 1XTBST, developed the blot by adding Clarity Western ECL substrate (Bio-Rad), visulaized bands after 3 s exposure.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FUSIP1 Antibody (H00010772-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUSIP1 Products

Bioinformatics Tool for FUSIP1 Antibody (H00010772-M07)

Discover related pathways, diseases and genes to FUSIP1 Antibody (H00010772-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUSIP1 Antibody (H00010772-M07)

Discover more about diseases related to FUSIP1 Antibody (H00010772-M07).
 

Pathways for FUSIP1 Antibody (H00010772-M07)

View related products by pathway.

PTMs for FUSIP1 Antibody (H00010772-M07)

Learn more about PTMs related to FUSIP1 Antibody (H00010772-M07).
 

Research Areas for FUSIP1 Antibody (H00010772-M07)

Find related products by research area.

Blogs on FUSIP1

There are no specific blogs for FUSIP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
10/10/2018
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol SRSF10
Entrez
Uniprot