SAM68 Antibody (1O7D1)

Western Blot: SAM68 Antibody (1O7D1) [NBP3-16289] - Western blot analysis of extracts of various cell lines, using KHDRBS1/SAM68 Rabbit mAb (NBP3-16289) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: SAM68 Antibody (1O7D1) [NBP3-16289] - Immunohistochemistry of paraffin-embedded mouse brain using KHDRBS1/SAM68 Rabbit mAb (NBP3-16289) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: SAM68 Antibody (1O7D1) [NBP3-16289] - Immunohistochemistry of paraffin-embedded rat brain using KHDRBS1/SAM68 Rabbit mAb (NBP3-16289) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: SAM68 Antibody (1O7D1) [NBP3-16289] - Immunohistochemistry of paraffin-embedded human colon using KHDRBS1/SAM68 Rabbit mAb (NBP3-16289) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: SAM68 Antibody (1O7D1) [NBP3-16289] - Confocal imaging of C6 cells using SAM68 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 1O7D1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SAM68 Antibody (1O7D1) Summary

• Description: Novus Biologicals Rabbit SAM68 Antibody (1O7D1) (NBP3-16289) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SAM68 (Q07666). MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: KHDRBS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SAM68 Antibody (1O7D1)

• FLJ34027
• GAP-associated tyrosine phosphoprotein p62
• KH domain containing, RNA binding, signal transduction associated 1
• KH domain-containing, RNA-binding, signal transduction-associated protein 1
• KHDRBS1
• p21 Ras GTPase-activating protein-associated p62
• p62
• p68
• SAM68
• Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68)
• Src-associated in mitosis 68 kDa protein

Background

Recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. Role in G2-M progression in the cell cycle. Represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. Also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export Function: Isoform 3, which is expressed in growth-arrested cells only, inhibits S phase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KHDRBS1