SALL3 Antibody

Images

 
Immunohistochemistry-Paraffin: SALL3 Antibody [NBP1-80587] - Staining of human spleen shows strong cytoplasmic positivity in the white pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SALL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AYDDKNAETLSSYDDDMDENSMEDDAELKDAATDPAKPLLSYAGSCPPSPPSVISSIAALENQMKMIDSVMSCQQLTGLKSVENGSGE
Specificity
Specificity of human SALL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SALL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SALL3 Protein (NBP1-80587PEP)
Publications
Read Publication using NBP1-80587.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SALL3 Antibody

  • C2H2 zinc finger protein SALL3
  • hSALL3
  • sal-like 3 (Drosophila)
  • spalt-like zinc finger protein
  • ZNF796

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-13276
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
H00003209-Q01
Species: Hu
NBP2-13948
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF482
Species: Mu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-80587
Species: Hu
Applications: IHC, IHC-P

Publications for SALL3 Antibody (NBP1-80587)(1)

Reviews for SALL3 Antibody (NBP1-80587) (0)

There are no reviews for SALL3 Antibody (NBP1-80587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SALL3 Antibody (NBP1-80587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SALL3 Antibody (NBP1-80587)

Discover related pathways, diseases and genes to SALL3 Antibody (NBP1-80587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SALL3 Antibody (NBP1-80587)

Discover more about diseases related to SALL3 Antibody (NBP1-80587).
 

Pathways for SALL3 Antibody (NBP1-80587)

View related products by pathway.

PTMs for SALL3 Antibody (NBP1-80587)

Learn more about PTMs related to SALL3 Antibody (NBP1-80587).

Blogs on SALL3

There are no specific blogs for SALL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SALL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SALL3