SALL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SALL2 Antibody [NBP2-13276] - Staining of human cell line A-431 shows positivity in vesicles.
Immunohistochemistry-Paraffin: SALL2 Antibody [NBP2-13276] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells, cells in molecular layer and cells in granular layer.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SALL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSN PPDSGSSVPTDPTWGPERRGEESSGHFLVAATGTAAGGGGGLILASPKLG ATPLPPESTPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SALL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SALL2 Protein (NBP2-13276PEP)
Publications
Read Publications using
NBP2-13276 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%). Mouse, Human reactivity reported in scientific literature (PMID: 26181197).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SALL2 Antibody

  • FLJ55746
  • Hsal2
  • KIAA0360sal (Drosophila)-like 2
  • p150(Sal2)
  • SAL2
  • Sal-2
  • sal-like 2 (Drosophila)
  • sal-like protein 2
  • Zinc finger protein 795
  • Zinc finger protein SALL2
  • Zinc finger protein Spalt-2
  • ZNF795FLJ10414

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00056996-R01
Species: Hu
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for SALL2 Antibody (NBP2-13276)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species

Reviews for SALL2 Antibody (NBP2-13276) (0)

There are no reviews for SALL2 Antibody (NBP2-13276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SALL2 Antibody (NBP2-13276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SALL2 Products

Bioinformatics Tool for SALL2 Antibody (NBP2-13276)

Discover related pathways, diseases and genes to SALL2 Antibody (NBP2-13276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SALL2 Antibody (NBP2-13276)

Discover more about diseases related to SALL2 Antibody (NBP2-13276).
 

Pathways for SALL2 Antibody (NBP2-13276)

View related products by pathway.

Blogs on SALL2

There are no specific blogs for SALL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SALL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SALL2