S100P Antibody

Images

 
Immunohistochemistry-Paraffin: S100P Antibody [NBP1-89541] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100P Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100P
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
S100P Protein (NBP1-89541PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100P Antibody

  • MIG9
  • migration-inducing gene 9
  • Protein S100-E
  • S100 calcium binding protein P
  • S100 calcium-binding protein Pprotein S100-P
  • S100E
  • S100P

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-48581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89541
Species: Hu
Applications: IHC, IHC-P

Publications for S100P Antibody (NBP1-89541) (0)

There are no publications for S100P Antibody (NBP1-89541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100P Antibody (NBP1-89541) (0)

There are no reviews for S100P Antibody (NBP1-89541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for S100P Antibody (NBP1-89541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100P Products

Bioinformatics Tool for S100P Antibody (NBP1-89541)

Discover related pathways, diseases and genes to S100P Antibody (NBP1-89541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100P Antibody (NBP1-89541)

Discover more about diseases related to S100P Antibody (NBP1-89541).
 

Pathways for S100P Antibody (NBP1-89541)

View related products by pathway.

PTMs for S100P Antibody (NBP1-89541)

Learn more about PTMs related to S100P Antibody (NBP1-89541).

Blogs on S100P

There are no specific blogs for S100P, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100P Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100P
Entrez