S100P Antibody - BSA Free

Immunohistochemistry-Paraffin: S100P Antibody [NBP1-89541] - Staining in human placenta and skeletal muscle tissues using anti-S100P antibody. Corresponding S100P RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: S100P Antibody [NBP1-89541] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: S100P Antibody [NBP1-89541] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100P Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit S100P Antibody - BSA Free (NBP1-89541) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100P
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  S100P Protein (NBP1-89541PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for S100P Antibody - BSA Free

• MIG9
• migration-inducing gene 9
• Protein S100-E
• S100 calcium binding protein P
• S100 calcium-binding protein Pprotein S100-P
• S100E
• S100P

Background

The protein encoded by the S100P gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100P