S100P binding protein Antibody

Images

 
Western Blot: S100P binding protein Antibody [NBP2-48581] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: S100P binding protein Antibody [NBP2-48581] - Staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: S100P binding protein Antibody [NBP2-48581] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100P binding protein Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PDLFKLPQLSTSSGHGPAHTKPLNRRSVLEKNLIKVTVAPFNPTVCDALLDKDETDSSKDTEKLSSLGEEMREDGLSPNESKLCTESEGISPNNS
Specificity
Specificity of human S100P binding protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100PBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S100P binding protein Recombinant Protein Antigen (NBP2-48581PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100P binding protein Antibody

  • DKFZp313K2325
  • FLJ12903
  • S100P binding protein
  • S100P-binding protein Riken
  • S100P-binding protein
  • S100PBPRS100P binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2957
Species: Hu
Applications: WB, ICC, KO
AF934
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IP
NB100-485
Species: Hu
Applications: WB, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP2-75542
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KO
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for S100P binding protein Antibody (NBP2-48581) (0)

There are no publications for S100P binding protein Antibody (NBP2-48581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100P binding protein Antibody (NBP2-48581) (0)

There are no reviews for S100P binding protein Antibody (NBP2-48581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100P binding protein Antibody (NBP2-48581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for S100P binding protein Antibody (NBP2-48581)

Discover related pathways, diseases and genes to S100P binding protein Antibody (NBP2-48581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100P binding protein Antibody (NBP2-48581)

Discover more about diseases related to S100P binding protein Antibody (NBP2-48581).
 

Pathways for S100P binding protein Antibody (NBP2-48581)

View related products by pathway.

Blogs on S100P binding protein

There are no specific blogs for S100P binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100P binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100PBP