Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT |
Specificity | Specificity of human, mouse, rat CACYBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CACYBP |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | IHC reported in scientific literature (PMID: 25324676). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-87104 | Applications | Species |
---|---|---|
Zhu Li, Miake Shou, Ijichi Ayako et al. Upregulated expression of calcyclin-binding protein/siah-1 interacting protein in malignant melanoma. Annals of Dermatology 2014 [PMID: 25324676] (IHC, Human) | IHC | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for CACYBP Antibody (NBP1-87104)Discover more about diseases related to CACYBP Antibody (NBP1-87104).
| Pathways for CACYBP Antibody (NBP1-87104)View related products by pathway.
|
PTMs for CACYBP Antibody (NBP1-87104)Learn more about PTMs related to CACYBP Antibody (NBP1-87104).
| Research Areas for CACYBP Antibody (NBP1-87104)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.