Home » CACYBP » CACYBP Antibodies » CACYBP Antibody

CACYBP Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: CACYBP Antibody [NBP1-87104] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CACYBP Antibody [NBP1-87104] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CACYBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
Specificity
Specificity of human, mouse, rat CACYBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACYBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25324676). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CACYBP Protein (NBP1-87104PEP)
Publications
Read Publication using
NBP1-87104 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CACYBP Antibody

  • CacyBP
  • calcyclin binding protein
  • GIG5
  • hCacyBP
  • MGC87971
  • RP1-102G20.6
  • S100A6-binding protein
  • S100A6BPgrowth-inhibiting gene 5 protein
  • Siah-interacting protein (SIP)
  • Siah-interacting protein
  • SIPcalcyclin-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

S100A6 Antibody
NBP1-89388
Western Blot: S100A6 Antibody [NBP1-89388] - Analysis in human cell lines PC-3 and HEK293 using anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: S100A6 Antibody [NBP1-89388] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining in human urinary bladder and liver tissues using anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - Beta-catening (green) was detected in human skin (psoriasis) using beta-catenin-FITC antibody (1:40) in PBS for 1 hour. Nuclei were stained with Dapi (blue). Image from verified customer review.
(3 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
S100B Antibody
(15F4NB)
NBP2-45224
Western Blot: S100B Antibody (15F4NB) [NBP2-45224] - Total protein from human brain (lane 1) and mouse brain (lane 2) was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane for 30 minutes and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-S100B in 1% milk and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: S100B Antibody (15F4NB) [NBP2-45224] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with S100B (15F9NB) at a 1:100 dilution overnight at 4 degrees Celsius and detected with Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were detected with DAPI (Blue) at 2.0 ug/ml in 1X PBS. Cells were imaged using a 40X objective. Image using the Azide Free form of this antibody.
Immunohistochemistry-Paraffin: S100B Antibody (15F4NB) [NBP2-45224] - Analysis using Azide Free version of NBP2-45224. IHC S100B in human prostate
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Skp1 Antibody
(4E11)
NBP2-37539
Western Blot: Skp1 Antibody (4E11) [NBP2-37539] - Western blot analysis using SKP1 mouse mAb against Hela (1), NIH/3T3 (2), A431 (3), RAJI (4), PC-12 (5), Cos7 (6), MCF-7 (7) and HepG2 (8) cell lysate.
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (4E11) [NBP2-37539] - Immunofluorescence analysis of Hela cells using SKP1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Skp1 Antibody (4E11) [NBP2-37539] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using SKP1 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
S100A1 Antibody
(4C4.9)
NBP2-29403
Western Blot: S100A1 Antibody (4C4.9) [NBP2-29403] - Analysis of human brain lysate using S100 antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 Ab (4C4.9).
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 4C4.9 antibody at 1:200 using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining.
(3 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in NIH 3T3 cell lysate.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(6 Reviews)
(13 Publications)
Species: Hu, Mu, Po, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
TBL1 Antibody
NB300-872
Immunohistochemistry-Paraffin: TBL1 Antibody [NB300-872] - Analysis in human Kidney shows preferential nuclear staining in the DCT. Antibody at 4 ug/mL. Steamed antigen retrieval with Tris/EDTA (pH 9), HRP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in control (vector only transfected HEK293T lysate) and HNF4A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining in human duodenum and tonsil tissues using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ZEB2 Antibody
NBP1-82991
Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
MBTPS1 Antibody
(9E538)
H00008720-M07
Immunocytochemistry/Immunofluorescence: MBTPS1 Antibody (2E6) [H00008720-M07] - Analysis of monoclonal antibody to MBTPS1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: MBTPS1 Antibody (2E6.) [H00008720-M07] - MBTPS1 Antibody (2E6) [H00008720-M07] - Detection limit for recombinant GST tagged MBTPS1 is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, ICC/IF
ALS Antibody
[Unconjugated]
AF1436
Western blot shows lysates of mouse spleen tissue, mouse liver tissue, and mouse bone marrow. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse IGFALS/ALS Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1436) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for IGFALS/ALS at approximately 80-90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
SUGT1 Antibody
NBP2-38518
Western Blot: SUGT1 Antibody [NBP2-38518] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry: SUGT1 Antibody [NBP2-38518] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(6 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Prion protein
Antibody (SC57-05)
NBP2-67569
Western Blot: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of PrP on different lysates using anti-PrP antibody at 1/1,000 dilution. Positive control: Lane 1: Rat brain Lane 2: Mouse brain
Immunocytochemistry/Immunofluorescence: Prion protein Antibody (SC57-05) [NBP2-67569] - Staining PrP in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of paraffin-embedded rat brain tissue using anti-PrP antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CACYBP Antibody (NBP1-87104)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CACYBP Antibody (NBP1-87104) (0)

There are no reviews for CACYBP Antibody (NBP1-87104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CACYBP Antibody (NBP1-87104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CACYBP Antibody (NBP1-87104)

Discover related pathways, diseases and genes to CACYBP Antibody (NBP1-87104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACYBP Antibody (NBP1-87104)

Discover more about diseases related to CACYBP Antibody (NBP1-87104).
 

Pathways for CACYBP Antibody (NBP1-87104)

View related products by pathway.

PTMs for CACYBP Antibody (NBP1-87104)

Learn more about PTMs related to CACYBP Antibody (NBP1-87104).
 

Research Areas for CACYBP Antibody (NBP1-87104)

Find related products by research area.

Blogs on CACYBP

There are no specific blogs for CACYBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACYBP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CACYBP
Entrez
Uniprot