CACYBP Antibody


Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunocytochemistry/ Immunofluorescence: CACYBP Antibody [NBP1-87104] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CACYBP Antibody [NBP1-87104] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CACYBP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
Specificity of human, mouse, rat CACYBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25324676). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Read Publication using
NBP1-87104 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CACYBP Antibody

  • CacyBP
  • calcyclin binding protein
  • GIG5
  • hCacyBP
  • MGC87971
  • RP1-102G20.6
  • S100A6-binding protein
  • S100A6BPgrowth-inhibiting gene 5 protein
  • Siah-interacting protein (SIP)
  • Siah-interacting protein
  • SIPcalcyclin-binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ChIP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CACYBP Antibody (NBP1-87104)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for CACYBP Antibody (NBP1-87104) (0)

There are no reviews for CACYBP Antibody (NBP1-87104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CACYBP Antibody (NBP1-87104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CACYBP Products

Bioinformatics Tool for CACYBP Antibody (NBP1-87104)

Discover related pathways, diseases and genes to CACYBP Antibody (NBP1-87104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACYBP Antibody (NBP1-87104)

Discover more about diseases related to CACYBP Antibody (NBP1-87104).

Pathways for CACYBP Antibody (NBP1-87104)

View related products by pathway.

PTMs for CACYBP Antibody (NBP1-87104)

Learn more about PTMs related to CACYBP Antibody (NBP1-87104).

Research Areas for CACYBP Antibody (NBP1-87104)

Find related products by research area.

Blogs on CACYBP

There are no specific blogs for CACYBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CACYBP Antibody and receive a gift card or discount.


Gene Symbol CACYBP
COVID-19 update