Home » CACYBP » CACYBP Antibodies » CACYBP Antibody

CACYBP Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: CACYBP Antibody [NBP1-87104] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CACYBP Antibody [NBP1-87104] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CACYBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACYBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25324676). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CACYBP Protein (NBP1-87104PEP)
Publications
Read Publication using
NBP1-87104 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CACYBP Antibody

  • CacyBP
  • calcyclin binding protein
  • GIG5
  • hCacyBP
  • MGC87971
  • RP1-102G20.6
  • S100A6-binding protein
  • S100A6BPgrowth-inhibiting gene 5 protein
  • Siah-interacting protein (SIP)
  • Siah-interacting protein
  • SIPcalcyclin-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

S100A6 Antibody
NBP1-89388
Western Blot: S100A6 Antibody [NBP1-89388] - Analysis in human cell lines PC-3 and HEK293 using anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: S100A6 Antibody [NBP1-89388] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(16 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
S100B Antibody
(15F9NB) - BSA Free
NBP2-45267
Flow Cytometry: S100B Antibody (15F9NB) [NBP2-45267] - An intracellular stain was performed on SK-MEL-28 cells with S100B [15F9NB] Antibody NBP2-45267PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: S100B Antibody (15F9NB) [NBP2-45267] - Staining of A431 cells (1 x 10^6 cells/ml) with S100B antibody, clone 15F4.1D2 (Orange) stained at a dilution of 1:500. Detected with a GtxRb DyLight 488 secondary. Shown with the secondary control (Blue).
Immunocytochemistry/Immunofluorescence: S100B Antibody (15F9NB) [NBP2-45267] - Analysis in A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with S100B (15F4NB) at a 1:100 dilution overnight at 4 degrees Celsius and detected with DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were detected with DAPI (Blue) at 2.0 ug/ml in 1X PBS. Cells were imaged using a 40X objective.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Skp1 Antibody
(JM27-37)
NBP2-67147
Flow Cytometry: Skp1 Antibody (JM27-37) [NBP2-67147] - Analysis of Hela cells with Skp1 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
S100A1 Antibody
NBP1-87103
Western Blot: S100A1 Antibody [NBP1-87103] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining of human heart muscle shows moderate to strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining in human heart muscle and lymph node tissues.. Corresponding S100A1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(38 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
TBL1 Antibody (2B6)
H00006907-M07
Immunohistochemistry-Paraffin: TBL1 Antibody (2B6) [H00006907-M07] - Analysis of monoclonal antibody to TBL1X on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.5 ug/ml
Sandwich ELISA: TBL1 Antibody (2B6) [H00006907-M07] - Detection limit for recombinant GST tagged TBL1X is approximately 0.3ng/ml as a capture antibody.
Proximity Ligation Assay: TBL1 Antibody (2B6) [H00006907-M07] - Analysis of protein-protein interactions between CACYBP and TBL1X. HeLa cells were stained with anti-CACYBP rabbit purified polyclonal 1:1200 and anti-TBL1X mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interacti
Species: Hu
Applications: ELISA, IHC, IHC-P, PLA, S-ELISA
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining in human duodenum and tonsil tissues using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same tissues.
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
ZEB2 Antibody
NBP1-82991
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.
(2 Reviews)
(22 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(12 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MBTPS1 Antibody
NBP3-05160
Immunocytochemistry/Immunofluorescence: MBTPS1 Antibody [NBP3-05160] - Analysis of U2OS cells using MBTPS1 antibody . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MBTPS1 Antibody [NBP3-05160] - Paraffin-embedded human colon cancer using MBTPS1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: MBTPS1 Antibody [NBP3-05160] - Paraffin-embedded human stomach using MBTPS1 antibody at dilution of 1:100 (40x lens).
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Erythropoietin/EPO
[HRP]
MEP00B
(3 Reviews)
(94 Publications)
Species: Mu
Applications: ELISA
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
ALS Antibody
[Unconjugated]
AF1436
Western blot shows lysates of mouse spleen tissue, mouse liver tissue, and mouse bone marrow. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse IGFALS/ALS Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1436) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for IGFALS/ALS at approximately 80-90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
SUGT1 Antibody
(1A10)
H00010910-M04
Immunoprecipitation: SUGT1 Antibody (1A10) [H00010910-M04] - Analysis of SUGT1 transfected lysate using anti-SUGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SUGT1 monoclonal antibody.
Western Blot: SUGT1 Antibody (1A10) [H00010910-M04] - Analysis of SUGT1 expression in PC-12 (Cat # L012V1).
Western Blot: SUGT1 Antibody (1A10) [H00010910-M04] - Analysis of SUGT1 expression in transfected 293T cell line by SUGT1 monoclonal antibody (M04), clone 1A10. Lane 1: SUGT1 transfected lysate (Predicted MW: 37.8 KDa). Lane 2: Non-transfected lysate.
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(7 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
PrPC Antibody
(SC57-05)
NBP2-67569
Flow Cytometry: PrPC Antibody (SC57-05) [NBP2-67569] - Analysis of SH-SY-5Y cells with PrPC antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for CACYBP Antibody (NBP1-87104)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CACYBP Antibody (NBP1-87104) (0)

There are no reviews for CACYBP Antibody (NBP1-87104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CACYBP Antibody (NBP1-87104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACYBP Products

Bioinformatics Tool for CACYBP Antibody (NBP1-87104)

Discover related pathways, diseases and genes to CACYBP Antibody (NBP1-87104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACYBP Antibody (NBP1-87104)

Discover more about diseases related to CACYBP Antibody (NBP1-87104).
 

Pathways for CACYBP Antibody (NBP1-87104)

View related products by pathway.

PTMs for CACYBP Antibody (NBP1-87104)

Learn more about PTMs related to CACYBP Antibody (NBP1-87104).
 

Research Areas for CACYBP Antibody (NBP1-87104)

Find related products by research area.

Blogs on CACYBP

There are no specific blogs for CACYBP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACYBP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CACYBP
Entrez
Uniprot