Home » CACYBP » CACYBP Antibodies » CACYBP Antibody

CACYBP Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: CACYBP Antibody [NBP1-87104] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CACYBP Antibody [NBP1-87104] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CACYBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
Specificity
Specificity of human, mouse, rat CACYBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACYBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25324676). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CACYBP Protein (NBP1-87104PEP)
Publications
Read Publication using
NBP1-87104 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CACYBP Antibody

  • CacyBP
  • calcyclin binding protein
  • GIG5
  • hCacyBP
  • MGC87971
  • RP1-102G20.6
  • S100A6-binding protein
  • S100A6BPgrowth-inhibiting gene 5 protein
  • Siah-interacting protein (SIP)
  • Siah-interacting protein
  • SIPcalcyclin-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

S100A6 Antibody
NBP1-89388
Western Blot: S100A6 Antibody [NBP1-89388] - Analysis in human cell lines PC-3 and HEK293 using anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: S100A6 Antibody [NBP1-89388] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(13 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
S100B Antibody
(15F9NB)
NBP2-45267
Western Blot: S100B Antibody (15F9NB) [NBP2-45267] - Total protein from human brain (1) and mouse brain (2) was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane for 30 minutes and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-S100B in 1% milk and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: S100B Antibody (15F9NB) [NBP2-45267] - Analysis in A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with S100B (15F4NB) at a 1:100 dilution overnight at 4 degrees Celsius and detected with DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were detected with DAPI (Blue) at 2.0 ug/ml in 1X PBS. Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: S100B Antibody (15F9NB) [NBP2-45267] - Analysis in human prostate tissue.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Recombinant Human
Skp1 Protein
NBP1-30173
SDS-Page: Recombinant Human Skp1 Protein [NBP1-30173] - 15% SDS-Page (3ug)
(1 Publication)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
S100A1 Antibody
(4C4.9)
NBP2-29403
Western Blot: S100A1 Antibody (4C4.9) [NBP2-29403] - Analysis of human brain lysate using S100 antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 Ab (4C4.9).
Immunohistochemistry-Paraffin: S100A1 Antibody (4C4.9) [NBP2-29403] - Formalin-fixed, paraffin-embedded human melanoma stained with S100 4C4.9 antibody at 1:200 using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining.
(3 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - VSOP observed in perivascular-restricted spinal cord lesions with intact BBB. Immunostaining for laminin (brown) shows vascular endothelium and glia limitans of a perivascular lesion, along with infiltrating cells and VSOP (blue). Image collected and cropped by CiteAb from the following publication (http://asn.sagepub.com/lookup/doi/10.1042/AN20120081), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Analysis in a 6 month old Alport mouse kidney. Image from a verified customer review.
(11 Reviews)
(32 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
TBL1 Antibody (2B6)
H00006907-M07
Immunohistochemistry-Paraffin: TBL1 Antibody (2B6) [H00006907-M07] - Analysis of monoclonal antibody to TBL1X on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.5 ug/ml
Sandwich ELISA: TBL1 Antibody (2B6) [H00006907-M07] - Detection limit for recombinant GST tagged TBL1X is approximately 0.3ng/ml as a capture antibody.
Proximity Ligation Assay: TBL1 Antibody (2B6) [H00006907-M07] - Analysis of protein-protein interactions between CACYBP and TBL1X. HeLa cells were stained with anti-CACYBP rabbit purified polyclonal 1:1200 and anti-TBL1X mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interacti
Species: Hu
Applications: ELISA, IHC, IHC-P, PLA, S-ELISA
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Frozen: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Frozen 8 um rat liver tissue section fixed in formalin. HNF-4 alpha antibody at 1:100 (green). Multiplexed with a myeloperoxidase antibody (red). DAPI staining in blue. IHC-Fr image submitted by a verified customer review.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
ZEB2 Antibody
NBP1-82991
Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (https://jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
(2 Reviews)
(19 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MBTPS1 Antibody
NBP3-05160
Western Blot: MBTPS1 Antibody [NBP3-05160] - Paraffin-embedded human colon using MBTPS1 antibody at dilution of 1:100 (40x lens).
Immunocytochemistry/Immunofluorescence: MBTPS1 Antibody [NBP3-05160] - Analysis of U2OS cells using MBTPS1 antibody. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MBTPS1 Antibody [NBP3-05160] - Paraffin-embedded human stomach using MBTPS1 antibody at dilution of 1:100 (40x lens).
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Erythropoietin/EPO
[HRP]
MEP00B
(3 Reviews)
(78 Publications)
Species: Mu
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
ALS Antibody
[Unconjugated]
AF1436
Western blot shows lysates of mouse spleen tissue, mouse liver tissue, and mouse bone marrow. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse IGFALS/ALS Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1436) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for IGFALS/ALS at approximately 80-90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
SUGT1 Antibody
(1A10)
H00010910-M04
Western Blot: SUGT1 Antibody (1A10) [H00010910-M04] - Analysis of SUGT1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: SUGT1 Antibody (1A10) [H00010910-M04] - Analysis of SUGT1 expression in PC-12 (Cat # L012V1).
Western Blot: SUGT1 Antibody (1A10) [H00010910-M04] - Analysis of SUGT1 expression in transfected 293T cell line by SUGT1 monoclonal antibody (M04), clone 1A10. Lane 1: SUGT1 transfected lysate (Predicted MW: 37.8 KDa). Lane 2: Non-transfected lysate.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(6 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Prion protein
Antibody (SC57-05)
NBP2-67569
Western Blot: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of Prion Protein(PrP) on rat brain tissue lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Prion protein Antibody (SC57-05) [NBP2-67569] - Staining PrP in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of paraffin-embedded rat brain tissue using anti-PrP antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CACYBP Antibody (NBP1-87104)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CACYBP Antibody (NBP1-87104) (0)

There are no reviews for CACYBP Antibody (NBP1-87104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CACYBP Antibody (NBP1-87104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CACYBP Products

Bioinformatics Tool for CACYBP Antibody (NBP1-87104)

Discover related pathways, diseases and genes to CACYBP Antibody (NBP1-87104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACYBP Antibody (NBP1-87104)

Discover more about diseases related to CACYBP Antibody (NBP1-87104).
 

Pathways for CACYBP Antibody (NBP1-87104)

View related products by pathway.

PTMs for CACYBP Antibody (NBP1-87104)

Learn more about PTMs related to CACYBP Antibody (NBP1-87104).
 

Research Areas for CACYBP Antibody (NBP1-87104)

Find related products by research area.

Blogs on CACYBP

There are no specific blogs for CACYBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACYBP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CACYBP
Entrez
Uniprot