S100B Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100B. Source: E. coli
Amino Acid Sequence: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
S100B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46626. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for S100B Recombinant Protein Antigen
Background
S100B is a zinc- and calcium-binding protein belonging to the S100 protein family within the EF-hand (helix E-loop-helix F) subgroup (1,2). S100B plays a role in normal central nervous system development, is associated with various neurological diseases such as Alzheimer's and Parkinson's, and it serves as a marker for brain injury (1,2). The S100B protein has a homodimeric structure comprised of two 91-amino acid polypeptide monomers each with a theoretical molecular weight of 10.5 kDa (1,2). Furthermore, each monomer contains two EF-hand regions, four helixes, and a hinge region (2). S100B is predominately expressed in astrocytes, oligodendrocytes, and Schwann cells, but also other cell types including adipocytes (1,3). S100B interacts with toll-like receptor 4 (TLR4) and receptor for advanced glycation end products (RAGE), initiating downstream signaling cascades and transcription factors including JNK/JUN, NFkappaB, and p38, leading to caspase and proinflammatory cytokine production (2). Overall outcomes include neuronal apoptosis, neuroinflammation, and neurodegeneration (1,2). S100B is the most commonly studied astroglia and blood brain barrier biomarker in traumatic brain injury (TBI) (3,4). The serum levels of S100B in patients with TBI is indicative of patient outcomes, where high levels correlate with injury severity and mortality (4). S100B is often in used in combination with additional biomarkers such as glial fibrillary acidic protein (GFAP) and ubiquitin c-terminal hydrolase L1 (UCH-L1) (3,4).
References
1. Yardan, T., Erenler, A. K., Baydin, A., Aydin, K., & Cokluk, C. (2011). Usefulness of S100B protein in neurological disorders. JPMA. The Journal of the Pakistan Medical Association, 61(3), 276-281.
2. Langeh, U., & Singh, S. (2021). Targeting S100B Protein as a Surrogate Biomarker and its Role in Various Neurological Disorders. Current neuropharmacology, 19(2), 265-277. https://doi.org/10.2174/1570159X18666200729100427
3. Thelin, E. P., Nelson, D. W., & Bellander, B. M. (2017). A review of the clinical utility of serum S100B protein levels in the assessment of traumatic brain injury. Acta neurochirurgica, 159(2), 209-225. https://doi.org/10.1007/s00701-016-3046-3
4. Wang, K. K., Yang, Z., Zhu, T., Shi, Y., Rubenstein, R., Tyndall, J. A., & Manley, G. T. (2018). An update on diagnostic and prognostic biomarkers for traumatic brain injury. Expert review of molecular diagnostics, 18(2), 165-180. https://doi.org/10.1080/14737159.2018.1428089
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
Species: Hu, Mu
Applications: IHC
Species: Mu
Applications: ICC, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Publications for S100B Recombinant Protein Antigen (NBP2-46626PEP) (0)
There are no publications for S100B Recombinant Protein Antigen (NBP2-46626PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for S100B Recombinant Protein Antigen (NBP2-46626PEP) (0)
There are no reviews for S100B Recombinant Protein Antigen (NBP2-46626PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for S100B Recombinant Protein Antigen (NBP2-46626PEP) (0)