ETFA Antibody


Western Blot: ETFA Antibody [NBP1-84854] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ETFA antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: ETFA Antibody [NBP1-84854] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
Western Blot: ETFA Antibody [NBP1-84854] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Western Blot: ETFA Antibody [NBP1-84854] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD

Order Details

ETFA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GGSASSEKASSTSPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAA
Specificity of human, mouse, rat ETFA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
ETFA Lysate (NBP2-65815)
Control Peptide
ETFA Protein (NBP1-84854PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ETFA Antibody

  • alpha-ETF
  • electron transfer flavoprotein alpha-subunit
  • Electron transfer flavoprotein subunit alpha, mitochondrial
  • electron-transfer-flavoprotein, alpha polypeptide
  • EMA
  • GA2
  • glutaric aciduria II
  • MADD


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for ETFA Antibody (NBP1-84854) (0)

There are no publications for ETFA Antibody (NBP1-84854).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETFA Antibody (NBP1-84854) (0)

There are no reviews for ETFA Antibody (NBP1-84854). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ETFA Antibody (NBP1-84854) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ETFA Antibody (NBP1-84854)

Discover related pathways, diseases and genes to ETFA Antibody (NBP1-84854). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETFA Antibody (NBP1-84854)

Discover more about diseases related to ETFA Antibody (NBP1-84854).

Pathways for ETFA Antibody (NBP1-84854)

View related products by pathway.

PTMs for ETFA Antibody (NBP1-84854)

Learn more about PTMs related to ETFA Antibody (NBP1-84854).

Research Areas for ETFA Antibody (NBP1-84854)

Find related products by research area.

Blogs on ETFA

There are no specific blogs for ETFA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ETFA Antibody and receive a gift card or discount.


Gene Symbol ETFA