S100A8 Antibody - BSA Free

Staining of human cell line HaCaT shows localization to intermediate filaments.

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining in human bone marrow and duodenum tissues using anti-S100A8 antibody. Corresponding S100A8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining of human duodenum shows low expression as expected.

Analysis in human cell line SK-BR-3.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit S100A8 Antibody - BSA Free (NBP1-90314) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-S100A8 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  S100A8 Recombinant Protein Antigen (NBP1-90314PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for S100A8 Antibody - BSA Free

• 60B8AG
• CAGACP-10
• Calgranulin A
• calgranulin-A
• Calprotectin L1L subunit
• CFAG
• CFAGL1Ag
• CGLA
• Cystic fibrosis antigen
• Leukocyte L1 complex light chain
• MA387
• MIF
• Migration inhibitory factor-related protein 8
• MRP8
• MRP-8
• MRP8S100 calcium binding protein A8 (calgranulin A)
• NIF
• P8
• protein S100-A8
• S100 calcium binding protein A8
• S100 calcium-binding protein A8 (calgranulin A)
• S100 calcium-binding protein A8
• S100A8
• Urinary stone protein band A

Background

MRP8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for S100A8 Antibody (NBP1-90314)(1)

Publication using NBP1-90314

• Ellis CN, LaRocque RC, Uddin T et al. Comparative Proteomic Analysis Reveals Activation of Mucosal Innate Immune Signaling Pathways during Cholera. Infect Immun 2015-03-01 [PMID: 25561705] (IF/IHC, Human)

FAQs for S100A8 Antibody (NBP1-90314). (Showing 1 - 2 of 2 FAQ).

1. Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?
   • Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.
2. We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.
   • Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Bioinformatics

• Gene Symbol: S100A8