S100A8 Antibody - BSA Free

Images

 
Staining of human cell line HaCaT shows localization to intermediate filaments.
Orthogonal Strategies: Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining in human bone marrow and duodenum tissues using anti-S100A8 antibody. Corresponding S100A8 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: S100A8 Antibody [NBP1-90314] - Staining of human duodenum shows low expression as expected.
Analysis in human cell line SK-BR-3.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

S100A8 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S100A8 Recombinant Protein Antigen (NBP1-90314PEP)
Publications
Read Publication using
NBP1-90314 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for S100A8 Antibody - BSA Free

  • 60B8AG
  • CAGACP-10
  • Calgranulin A
  • calgranulin-A
  • Calprotectin L1L subunit
  • CFAG
  • CFAGL1Ag
  • CGLA
  • Cystic fibrosis antigen
  • Leukocyte L1 complex light chain
  • MA387
  • MIF
  • Migration inhibitory factor-related protein 8
  • MRP8
  • MRP-8
  • MRP8S100 calcium binding protein A8 (calgranulin A)
  • NIF
  • P8
  • protein S100-A8
  • S100 calcium binding protein A8
  • S100 calcium-binding protein A8 (calgranulin A)
  • S100 calcium-binding protein A8
  • S100A8
  • Urinary stone protein band A

Background

MRP8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
DY1707
Species: Hu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-62583
Species: Hu
Applications: WB
NBP1-90314
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for S100A8 Antibody (NBP1-90314)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for S100A8 Antibody (NBP1-90314) (0)

There are no reviews for S100A8 Antibody (NBP1-90314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A8 Antibody (NBP1-90314). (Showing 1 - 2 of 2 FAQ).

  1. Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?
    • Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.
  2. We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.
    • Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Secondary Antibodies

 

Isotype Controls

Additional S100A8 Products

Research Areas for S100A8 Antibody (NBP1-90314)

Find related products by research area.

Blogs on S100A8

There are no specific blogs for S100A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A8 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A8