S100A5 Antibody

Images

 
Western Blot: S100A5 Antibody [NBP1-98577] - Mouse Small Intestine Lysate 1.0ug/ml, Gel Concentration: 10-20%

Product Details

Summary
Reactivity Mu, Hu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100A5 Antibody Summary

Immunogen
The immunogen for this antibody is S100a5 - middle region. Peptide sequence SLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDN. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for S100A5 Antibody

  • Protein S-100D
  • S100 calcium binding protein A5
  • S100 calcium-binding protein A5S100Dprotein S100-A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54679
Species: Hu
Applications: WB, IHC, IHC-P
H00006275-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
NBP2-79764
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PA
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86039
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB2957
Species: Hu
Applications: WB, ICC, KO
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4874
Species: Hu
Applications: WB, IHC
NB100-56559
Species: Hu
Applications: WB, Simple Western, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-90000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1197
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for S100A5 Antibody (NBP1-98577) (0)

There are no publications for S100A5 Antibody (NBP1-98577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A5 Antibody (NBP1-98577) (0)

There are no reviews for S100A5 Antibody (NBP1-98577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A5 Antibody (NBP1-98577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional S100A5 Products

Bioinformatics Tool for S100A5 Antibody (NBP1-98577)

Discover related pathways, diseases and genes to S100A5 Antibody (NBP1-98577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A5 Antibody (NBP1-98577)

Discover more about diseases related to S100A5 Antibody (NBP1-98577).
 

Pathways for S100A5 Antibody (NBP1-98577)

View related products by pathway.

Blogs on S100A5

There are no specific blogs for S100A5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A5
Uniprot