![Western Blot: RUNX3/CBFA3 Antibody [NBP2-38863] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30](http://images.novusbio.com/fullsize/RUNX3-CBFA3-Antibody-Western-Blot-NBP2-38863-img0002.jpg "Western Blot: RUNX3/CBFA3 Antibody [NBP2-38863] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RUNX3/CBFA3 Antibody - BSA Free (NBP2-38863) is a polyclonal antibody validated for use in IHC and WB. Anti-RUNX3/CBFA3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RUNX3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Publication using NBP2-38863 | Applications | Species |
|---|---|---|
| Burda JE, O'Shea TM, Ao Y et al. Divergent transcriptional regulation of astrocyte reactivity across disorders Nature 2022-05-25 [PMID: 35614216] (IHC-Fr, Mouse) | IHC-Fr | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for RUNX3/CBFA3 Antibody (NBP2-38863)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RUNX3/CBFA3 Antibody [NBP2-38863] - Staining in human lymph node and cerebral cortex tissues using anti-RUNX3 antibody. Corresponding RUNX3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RUNX3-CBFA3-Antibody-Immunohistochemistry-Paraffin-NBP2-38863-img0005.jpg "Immunohistochemistry-Paraffin: RUNX3/CBFA3 Antibody [NBP2-38863] - Staining in human lymph node and cerebral cortex tissues using anti-RUNX3 antibody. Corresponding RUNX3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: RUNX3/CBFA3 Antibody [NBP2-38863] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/RUNX3-CBFA3-Antibody-Immunohistochemistry-Paraffin-NBP2-38863-img0003.jpg "Immunohistochemistry-Paraffin: RUNX3/CBFA3 Antibody [NBP2-38863] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: RUNX3/CBFA3 Antibody [NBP2-38863] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/RUNX3-CBFA3-Antibody-Immunohistochemistry-Paraffin-NBP2-38863-img0004.jpg "Immunohistochemistry-Paraffin: RUNX3/CBFA3 Antibody [NBP2-38863] - Staining of human lymph node shows high expression.")
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Immunohistochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images/mab2006_human-runx2-cbfa1-mab-clone-232902-812025555286.jpg)
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")