Invadolysin Antibody

Images

 
Western Blot: Invadolysin Antibody [NBP1-92025] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Invadolysin Antibody [NBP1-92025] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Invadolysin Antibody [NBP1-92025] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: Invadolysin Antibody [NBP1-92025] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Invadolysin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWDFC
Specificity
Specificity of human, mouse, rat Invadolysin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Invadolysin Protein (NBP1-92025PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Invadolysin Antibody

  • GP63
  • INV
  • invadolysin
  • IX14
  • leishmanolysin-2
  • leishmanolysin-like (metallopeptidase M8 family)
  • leishmanolysin-like peptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-45545
Species: Hu
Applications: WB, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF691
Species: Hu
Applications: WB, IP, Block
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Invadolysin Antibody (NBP1-92025) (0)

There are no publications for Invadolysin Antibody (NBP1-92025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Invadolysin Antibody (NBP1-92025) (0)

There are no reviews for Invadolysin Antibody (NBP1-92025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Invadolysin Antibody (NBP1-92025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Invadolysin Antibody (NBP1-92025)

Discover related pathways, diseases and genes to Invadolysin Antibody (NBP1-92025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Invadolysin Antibody (NBP1-92025)

Discover more about diseases related to Invadolysin Antibody (NBP1-92025).
 

Pathways for Invadolysin Antibody (NBP1-92025)

View related products by pathway.

Blogs on Invadolysin

There are no specific blogs for Invadolysin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Invadolysin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMLN