RTN4IP1 Antibody

Images

 
Western Blot: RTN4IP1 Antibody [NBP1-82568] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: RTN4IP1 Antibody [NBP1-82568] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RTN4IP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTN4IP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RTN4IP1 Protein (NBP1-82568PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RTN4IP1 Antibody

  • MGC12934
  • NIMPNOGO-interacting mitochondrial protein
  • reticulon 4 interacting protein 1
  • reticulon-4-interacting protein 1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF9024
Species: Mu, Rt
Applications: WB, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-61572
Species: Hu, Bv, Pm
Applications: WB
NBP1-82568
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RTN4IP1 Antibody (NBP1-82568) (0)

There are no publications for RTN4IP1 Antibody (NBP1-82568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTN4IP1 Antibody (NBP1-82568) (0)

There are no reviews for RTN4IP1 Antibody (NBP1-82568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RTN4IP1 Antibody (NBP1-82568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTN4IP1 Products

Bioinformatics Tool for RTN4IP1 Antibody (NBP1-82568)

Discover related pathways, diseases and genes to RTN4IP1 Antibody (NBP1-82568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTN4IP1 Antibody (NBP1-82568)

Discover more about diseases related to RTN4IP1 Antibody (NBP1-82568).
 

Pathways for RTN4IP1 Antibody (NBP1-82568)

View related products by pathway.

Blogs on RTN4IP1

There are no specific blogs for RTN4IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTN4IP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTN4IP1